KEGG   Homo sapiens (human): 996Help
Entry
996               CDS       T01001                                 

Gene name
CDC27, ANAPC3, APC3, CDC27Hs, D0S1430E, D17S978E, H-NUC, HNUC, NUC2
Definition
(RefSeq) cell division cycle 27
  KO
K03350  
anaphase-promoting complex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    996 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    996 (CDC27)
   04114 Oocyte meiosis
    996 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    996 (CDC27)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    996 (CDC27)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     996 (CDC27)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     996 (CDC27)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    996 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.32
AA seq 824 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCL
PNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTP
QVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQ
PNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYS
TTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNY
AYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQK
ALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAID
KRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccactatgct
taccgagatgcggttttcctcgcagaacgcctttatgcagaagtacactcagaagaagcc
ttgtttttactggcaacctgttattaccgctcaggaaaggcatataaagcatatagactc
ttgaaaggacacagttgtactacaccgcaatgcaaatacctgcttgcaaaatgttgtgtt
gatctcagcaagcttgcagaaggggaacaaatcttatctggtggagtgtttaataagcag
aaaagccatgatgatattgttactgagtttggtgattcagcttgctttactctttcattg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattcacatctttacagaactttagcaactgtctg
cccaactcttgcacaacacaagtacctaatcatagtttatctcacagacagcctgagaca
gttcttacggaaacaccccaggacacaattgaattaaacagattgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctcagtgtcttatattgattcagctgtaatt
tcacctgatactgtcccactgggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttattaggaggaccagcagctcttagtccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacacctcctgtaattgatgtgccatccaccggagccccttcaaaaaagtct
gttgccagaatcggccaaactggaacaaagtctgtcttctcacagagtggaaatagccga
gaggtaactccaattcttgcacaaacacaaagttctggtccacaaacaagtacaacacct
caggtattgagccccactattacatctcccccaaacgcactgcctcgaagaagttcacga
ctctttactagtgacagctccacaaccaaggagaatagcaaaaaattaaaaatgaagttt
ccacctaaaatcccaaacagaaaaacaaaaagtaaaactaataaaggaggaataactcaa
cctaacataaatgatagcctggaaattacaaaattggactcttccatcatttcagaaggg
aaaatatccacaatcacacctcagattcaggcctttaatctacaaaaagcagcagcagaa
ggtttgatgagccttcttcgtgaaatggggaaaggttatttagctttgtgttcatacaac
tgcaaagaagctataaatattttgagccatctaccttctcaccactacaatactggttgg
gtactgtgccaaattggaagggcctattttgaactttcagagtacatgcaagctgaaaga
atattctcagaggttagaaggattgagaattatagagttgaaggcatggagatctactct
acaacactttggcatcttcaaaaagatgttgctctttcagttctgtcaaaagacttaaca
gacatggataaaaattcgccagaggcctggtgtgctgcagggaactgtttcagtctgcaa
cgggaacatgatattgcaattaaattcttccagagagctatccaagttgatccaaattac
gcttatgcctatactctattagggcatgagtttgtcttaactgaagaattggacaaagca
ttagcttgttttcgaaatgctatcagagtcaatcctagacattataatgcatggtatggt
ttaggaatgatttattacaagcaagaaaaattcagccttgcagaaatgcatttccaaaaa
gcgcttgatatcaaccctcaaagttcagttttactttgccacattggagtagttcaacat
gcactgaaaaaatcagagaaggctttggataccctaaacaaagccattgtcattgatccc
aagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatataag
tctgctttacaagaacttgaagaattgaaacaaattgttcccaaagaatccctcgtttac
ttcttaataggaaaggtttacaagaagttaggtcaaacgcacctcgccctgatgaatttc
tcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaattgat
aagcgttatcttccagatgatgaggagccaataacccaagaagaacagatcatgggaaca
gatgaatcccaggagagcagcatgacagatgcggatgacacacaacttcatgcagctgaa
agtgatgaattttaa

DBGET integrated database retrieval system