KEGG   Homo sapiens (human): 9978Help
Entry
9978              CDS       T01001                                 

Gene name
RBX1, BA554C12.1, RNF75, ROC1
Definition
ring-box 1, E3 ubiquitin protein ligase
Orthology
K03868  
RING-box protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Nucleotide excision repair
HIF-1 signaling pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Wnt signaling pathway
TGF-beta signaling pathway
Circadian rhythm
Pathways in cancer
Renal cell carcinoma
Module
SCF-BTRC complex
SCF-SKP2 complex
SCF-FBS complex
ECV complex
Cul3-SPOP complex
Cul4-DDB1-DDB2 complex
Cul4-DDB1-CSA complex
SCF-FBW7 complex
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:hsa03420]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:hsa04710]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.2
AA seq 108 aa AA seqDB search
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag
cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat
aactgtgccatctgcaggaaccacattatggatctttgcatagaatgtcaagctaaccag
gcgtccgctacttcagaagagtgtactgtcgcatggggagtctgtaaccatgcttttcac
ttccactgcatctctcgctggctcaaaacacgacaggtgtgtccattggacaacagagag
tgggaattccaaaagtatgggcactag

DBGET integrated database retrieval system