KEGG   Homo sapiens (human): 9978Help
Entry
9978              CDS       T01001                                 

Gene name
RBX1, BA554C12.1, RNF75, ROC1
Definition
ring-box 1, E3 ubiquitin protein ligase
Orthology
K03868  
RING-box protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Nucleotide excision repair
HIF-1 signaling pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Wnt signaling pathway
TGF-beta signaling pathway
Circadian rhythm
Pathways in cancer
Renal cell carcinoma
Module
SCF-BTRC complex
SCF-SKP2 complex
SCF-FBS complex
ECV complex
Cul3-SPOP complex
Cul4-DDB1-DDB2 complex
Cul4-DDB1-CSA complex
SCF-FBW7 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9978 (RBX1)
   04120 Ubiquitin mediated proteolysis
    9978 (RBX1)
  Replication and repair
   03420 Nucleotide excision repair
    9978 (RBX1)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    9978 (RBX1)
   04350 TGF-beta signaling pathway
    9978 (RBX1)
   04066 HIF-1 signaling pathway
    9978 (RBX1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    9978 (RBX1)
   04114 Oocyte meiosis
    9978 (RBX1)
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    9978 (RBX1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    9978 (RBX1)
   05211 Renal cell carcinoma
    9978 (RBX1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     9978 (RBX1)
   ECV complex
     9978 (RBX1)
   Cul3 complex
     9978 (RBX1)
   Cul4 complex
     9978 (RBX1)
   Cul7 complex
     9978 (RBX1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      9978 (RBX1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      9978 (RBX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.2
AA seq 108 aa AA seqDB search
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag
cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat
aactgtgccatctgcaggaaccacattatggatctttgcatagaatgtcaagctaaccag
gcgtccgctacttcagaagagtgtactgtcgcatggggagtctgtaaccatgcttttcac
ttccactgcatctctcgctggctcaaaacacgacaggtgtgtccattggacaacagagag
tgggaattccaaaagtatgggcactag

DBGET integrated database retrieval system