KEGG   Homo sapiens (human): 998Help
Entry
998               CDS       T01001                                 

Gene name
CDC42, CDC42Hs, G25K
Definition
cell division cycle 42
Orthology
K04393  
cell division control protein 42
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Endocytosis
Axon guidance
VEGF signaling pathway
Focal adhesion
Adherens junction
Tight junction
T cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
GnRH signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Bacterial invasion of epithelial cells
Epithelial cell signaling in Helicobacter pylori infection
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Renal cell carcinoma
Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    998 (CDC42)
   04015 Rap1 signaling pathway
    998 (CDC42)
   04010 MAPK signaling pathway
    998 (CDC42)
   04370 VEGF signaling pathway
    998 (CDC42)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    998 (CDC42)
  Cell motility
   04810 Regulation of actin cytoskeleton
    998 (CDC42)
  Cell communication
   04510 Focal adhesion
    998 (CDC42)
   04520 Adherens junction
    998 (CDC42)
   04530 Tight junction
    998 (CDC42)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    998 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    998 (CDC42)
   04670 Leukocyte transendothelial migration
    998 (CDC42)
   04062 Chemokine signaling pathway
    998 (CDC42)
  Endocrine system
   04912 GnRH signaling pathway
    998 (CDC42)
  Nervous system
   04722 Neurotrophin signaling pathway
    998 (CDC42)
  Development
   04360 Axon guidance
    998 (CDC42)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    998 (CDC42)
   05205 Proteoglycans in cancer
    998 (CDC42)
   05203 Viral carcinogenesis
    998 (CDC42)
   05212 Pancreatic cancer
    998 (CDC42)
   05211 Renal cell carcinoma
    998 (CDC42)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    998 (CDC42)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    998 (CDC42)
   05130 Pathogenic Escherichia coli infection
    998 (CDC42)
   05132 Salmonella infection
    998 (CDC42)
   05131 Shigellosis
    998 (CDC42)
   05100 Bacterial invasion of epithelial cells
    998 (CDC42)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   998 (CDC42)
  Exosomal proteins of breast milk
   998 (CDC42)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    998 (CDC42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.1
AA seq 191 aa AA seqDB search
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgtgggcgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccatcggaatatgtaccgactgtttttgacaactat
gcagtcacagttatgattggtggagaaccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcttcatttgaaaacgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggactcaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcctatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactt
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system