KEGG   Homo sapiens (human): 999Help
Entry
999               CDS       T01001                                 

Gene name
CDH1, Arc-1, CD324, CDHE, ECAD, LCAM, UVO
Definition
cadherin 1, type 1, E-cadherin (epithelial)
Orthology
K05689  
cadherin 1, type 1, E-cadherin
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Hippo signaling pathway
Cell adhesion molecules (CAMs)
Adherens junction
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Pathways in cancer
Endometrial cancer
Thyroid cancer
Melanoma
Bladder cancer
Disease
H00018  
Gastric cancer
H00025  
Penile cancer
H00031  
Breast cancer
H00032  
Thyroid cancer
H00048  
Hepatocellular carcinoma
H00054  
Nasopharyngeal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    999 (CDH1)
   04390 Hippo signaling pathway
    999 (CDH1)
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    999 (CDH1)
 Cellular Processes
  Cell communication
   04520 Adherens junction
    999 (CDH1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    999 (CDH1)
   05216 Thyroid cancer
    999 (CDH1)
   05218 Melanoma
    999 (CDH1)
   05219 Bladder cancer
    999 (CDH1)
   05213 Endometrial cancer
    999 (CDH1)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    999 (CDH1)
   05100 Bacterial invasion of epithelial cells
    999 (CDH1)
Cellular antigens [BR:hsa04090]
 Proteins
  999 (CDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q22.1
AA seq 882 aa AA seqDB search
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGN
AVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTAT
AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG
GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTG
AISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV
GDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILAL
LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP
EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgggcccttggagccgcagcctctcggcgctgctgctgctgctgcaggtctcctcttgg
ctctgccaggagccggagccctgccaccctggctttgacgccgagagctacacgttcacg
gtgccccggcgccacctggagagaggccgcgtcctgggcagagtgaattttgaagattgc
accggtcgacaaaggacagcctatttttccctcgacacccgattcaaagtgggcacagat
ggtgtgattacagtcaaaaggcctctacggtttcataacccacagatccatttcttggtc
tacgcctgggactccacctacagaaagttttccaccaaagtcacgctgaatacagtgggg
caccaccaccgccccccgccccatcaggcctccgtttctggaatccaagcagaattgctc
acatttcccaactcctctcctggcctcagaagacagaagagagactgggttattcctccc
atcagctgcccagaaaatgaaaaaggcccatttcctaaaaacctggttcagatcaaatcc
aacaaagacaaagaaggcaaggttttctacagcatcactggccaaggagctgacacaccc
cctgttggtgtctttattattgaaagagaaacaggatggctgaaggtgacagagcctctg
gatagagaacgcattgccacatacactctcttctctcacgctgtgtcatccaacgggaat
gcagttgaggatccaatggagattttgatcacggtaaccgatcagaatgacaacaagccc
gaattcacccaggaggtctttaaggggtctgtcatggaaggtgctcttccaggaacctct
gtgatggaggtcacagccacagacgcggacgatgatgtgaacacctacaatgccgccatc
gcttacaccatcctcagccaagatcctgagctccctgacaaaaatatgttcaccattaac
aggaacacaggagtcatcagtgtggtcaccactgggctggaccgagagagtttccctacg
tataccctggtggttcaagctgctgaccttcaaggtgaggggttaagcacaacagcaaca
gctgtgatcacagtcactgacaccaacgataatcctccgatcttcaatcccaccacgtac
aagggtcaggtgcctgagaacgaggctaacgtcgtaatcaccacactgaaagtgactgat
gctgatgcccccaataccccagcgtgggaggctgtatacaccatattgaatgatgatggt
ggacaatttgtcgtcaccacaaatccagtgaacaacgatggcattttgaaaacagcaaag
ggcttggattttgaggccaagcagcagtacattctacacgtagcagtgacgaatgtggta
ccttttgaggtctctctcaccacctccacagccaccgtcaccgtggatgtgctggatgtg
aatgaagcccccatctttgtgcctcctgaaaagagagtggaagtgtccgaggactttggc
gtgggccaggaaatcacatcctacactgcccaggagccagacacatttatggaacagaaa
ataacatatcggatttggagagacactgccaactggctggagattaatccggacactggt
gccatttccactcgggctgagctggacagggaggattttgagcacgtgaagaacagcacg
tacacagccctaatcatagctacagacaatggttctccagttgctactggaacagggaca
cttctgctgatcctgtctgatgtgaatgacaacgcccccataccagaacctcgaactata
ttcttctgtgagaggaatccaaagcctcaggtcataaacatcattgatgcagaccttcct
cccaatacatctcccttcacagcagaactaacacacggggcgagtgccaactggaccatt
cagtacaacgacccaacccaagaatctatcattttgaagccaaagatggccttagaggtg
ggtgactacaaaatcaatctcaagctcatggataaccagaataaagaccaagtgaccacc
ttagaggtcagcgtgtgtgactgtgaaggggccgctggcgtctgtaggaaggcacagcct
gtcgaagcaggattgcaaattcctgccattctggggattcttggaggaattcttgctttg
ctaattctgattctgctgctcttgctgtttcttcggaggagagcggtggtcaaagagccc
ttactgcccccagaggatgacacccgggacaacgtttattactatgatgaagaaggaggc
ggagaagaggaccaggactttgacttgagccagctgcacaggggcctggacgctcggcct
gaagtgactcgtaacgacgttgcaccaaccctcatgagtgtcccccggtatcttccccgc
cctgccaatcccgatgaaattggaaattttattgatgaaaatctgaaagcggctgatact
gaccccacagccccgccttatgattctctgctcgtgtttgactatgaaggaagcggttcc
gaagctgctagtctgagctccctgaactcctcagagtcagacaaagaccaggactatgac
tacttgaacgaatggggcaatcgcttcaagaagctggctgacatgtacggaggcggcgag
gacgactag

DBGET integrated database retrieval system