KEGG   Homo sapiens (human): 999Help
Entry
999               CDS       T01001                                 

Gene name
CDH1, Arc-1, CD324, CDHE, ECAD, LCAM, UVO
Definition
cadherin 1, type 1, E-cadherin (epithelial)
Orthology
K05689  
cadherin 1, type 1, E-cadherin
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Hippo signaling pathway
Cell adhesion molecules (CAMs)
Adherens junction
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Pathways in cancer
Endometrial cancer
Thyroid cancer
Melanoma
Bladder cancer
Disease
H00018  
Gastric cancer
H00025  
Penile cancer
H00031  
Breast cancer
H00032  
Thyroid cancer
H00048  
Hepatocellular carcinoma
H00054  
Nasopharyngeal cancer
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Thyroid cancer [PATH:hsa05216]
Human Diseases; Cancers; Melanoma [PATH:hsa05218]
Human Diseases; Cancers; Bladder cancer [PATH:hsa05219]
Human Diseases; Cancers; Endometrial cancer [PATH:hsa05213]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q22.1
AA seq 882 aa AA seqDB search
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGN
AVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTAT
AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG
GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTG
AISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV
GDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILAL
LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP
EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgggcccttggagccgcagcctctcggcgctgctgctgctgctgcaggtctcctcttgg
ctctgccaggagccggagccctgccaccctggctttgacgccgagagctacacgttcacg
gtgccccggcgccacctggagagaggccgcgtcctgggcagagtgaattttgaagattgc
accggtcgacaaaggacagcctatttttccctcgacacccgattcaaagtgggcacagat
ggtgtgattacagtcaaaaggcctctacggtttcataacccacagatccatttcttggtc
tacgcctgggactccacctacagaaagttttccaccaaagtcacgctgaatacagtgggg
caccaccaccgccccccgccccatcaggcctccgtttctggaatccaagcagaattgctc
acatttcccaactcctctcctggcctcagaagacagaagagagactgggttattcctccc
atcagctgcccagaaaatgaaaaaggcccatttcctaaaaacctggttcagatcaaatcc
aacaaagacaaagaaggcaaggttttctacagcatcactggccaaggagctgacacaccc
cctgttggtgtctttattattgaaagagaaacaggatggctgaaggtgacagagcctctg
gatagagaacgcattgccacatacactctcttctctcacgctgtgtcatccaacgggaat
gcagttgaggatccaatggagattttgatcacggtaaccgatcagaatgacaacaagccc
gaattcacccaggaggtctttaaggggtctgtcatggaaggtgctcttccaggaacctct
gtgatggaggtcacagccacagacgcggacgatgatgtgaacacctacaatgccgccatc
gcttacaccatcctcagccaagatcctgagctccctgacaaaaatatgttcaccattaac
aggaacacaggagtcatcagtgtggtcaccactgggctggaccgagagagtttccctacg
tataccctggtggttcaagctgctgaccttcaaggtgaggggttaagcacaacagcaaca
gctgtgatcacagtcactgacaccaacgataatcctccgatcttcaatcccaccacgtac
aagggtcaggtgcctgagaacgaggctaacgtcgtaatcaccacactgaaagtgactgat
gctgatgcccccaataccccagcgtgggaggctgtatacaccatattgaatgatgatggt
ggacaatttgtcgtcaccacaaatccagtgaacaacgatggcattttgaaaacagcaaag
ggcttggattttgaggccaagcagcagtacattctacacgtagcagtgacgaatgtggta
ccttttgaggtctctctcaccacctccacagccaccgtcaccgtggatgtgctggatgtg
aatgaagcccccatctttgtgcctcctgaaaagagagtggaagtgtccgaggactttggc
gtgggccaggaaatcacatcctacactgcccaggagccagacacatttatggaacagaaa
ataacatatcggatttggagagacactgccaactggctggagattaatccggacactggt
gccatttccactcgggctgagctggacagggaggattttgagcacgtgaagaacagcacg
tacacagccctaatcatagctacagacaatggttctccagttgctactggaacagggaca
cttctgctgatcctgtctgatgtgaatgacaacgcccccataccagaacctcgaactata
ttcttctgtgagaggaatccaaagcctcaggtcataaacatcattgatgcagaccttcct
cccaatacatctcccttcacagcagaactaacacacggggcgagtgccaactggaccatt
cagtacaacgacccaacccaagaatctatcattttgaagccaaagatggccttagaggtg
ggtgactacaaaatcaatctcaagctcatggataaccagaataaagaccaagtgaccacc
ttagaggtcagcgtgtgtgactgtgaaggggccgctggcgtctgtaggaaggcacagcct
gtcgaagcaggattgcaaattcctgccattctggggattcttggaggaattcttgctttg
ctaattctgattctgctgctcttgctgtttcttcggaggagagcggtggtcaaagagccc
ttactgcccccagaggatgacacccgggacaacgtttattactatgatgaagaaggaggc
ggagaagaggaccaggactttgacttgagccagctgcacaggggcctggacgctcggcct
gaagtgactcgtaacgacgttgcaccaaccctcatgagtgtcccccggtatcttccccgc
cctgccaatcccgatgaaattggaaattttattgatgaaaatctgaaagcggctgatact
gaccccacagccccgccttatgattctctgctcgtgtttgactatgaaggaagcggttcc
gaagctgctagtctgagctccctgaactcctcagagtcagacaaagaccaggactatgac
tacttgaacgaatggggcaatcgcttcaagaagctggctgacatgtacggaggcggcgag
gacgactag

DBGET integrated database retrieval system