KEGG   Homo sapiens (human): 9992Help
Entry
9992              CDS       T01001                                 

Gene name
KCNE2, ATFB4, LQT5, LQT6, MIRP1
Definition
potassium voltage-gated channel, Isk-related family, member 2
Orthology
K04896  
potassium voltage-gated channel Isk-related subfamily E member 2
Organism
hsa  Homo sapiens (human)
Pathway
Gastric acid secretion
Disease
H00720  
Long QT syndrome
H00731  
Atrial fibrillation
Class
Organismal Systems; Digestive system; Gastric acid secretion [PATH:hsa04971]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
21q22.12
AA seq 123 aa AA seqDB search
MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMF
SFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFK
MSP
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtctactttatccaatttcacacagacgctggaagacgtcttccgaaggatttttatt
acttatatggacaattggcgccagaacacaacagctgagcaagaggccctccaagccaaa
gttgatgctgagaacttctactatgtcatcctgtacctcatggtgatgattggaatgttc
tctttcatcatcgtggccatcctggtgagcactgtgaaatccaagagacgggaacactcc
aatgacccctaccaccagtacattgtagaggactggcaggaaaagtacaagagccaaatc
ttgaatctagaagaatcgaaggccaccatccatgagaacattggtgcggctgggttcaaa
atgtccccctga

DBGET integrated database retrieval system