KEGG   Ignavibacterium album: IALB_2926Help
Entry
IALB_2926         CDS       T01943                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase 1
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ial  Ignavibacterium album
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    IALB_2926 (gpm)
   01230 Biosynthesis of amino acids
    IALB_2926 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IALB_2926 (gpm)
  Energy metabolism
   00680 Methane metabolism
    IALB_2926 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    IALB_2926 (gpm)
Enzymes [BR:ial01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     IALB_2926 (gpm)
Exosome [BR:ial04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   IALB_2926 (gpm)
  Exosomal proteins of melanoma cells
   IALB_2926 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3326312..3327058
Genome map
AA seq 248 aa AA seqDB search
MYKVVLLRHGESIWNKENRFTGWTDVDLSEKGKEEAKKAGEVLKSEGYTFDIAYTSVLKR
AIRTLWIVLDEMDLMWIPVIRHWRLNERHYGALQGLNKAETAKKYGEEQVKIWRRSYDIQ
PPALEKSDPRYPGHDPRYKDLSESELPLTECLKDTVARFVPYWEGTIAPMVKSGKKVLIT
AHGNSLRALVKYLDNIPDNEIVELNIPTGIPLVYELDENLKPIKHYYLGNPEEIEKAAAA
VAAQAKVK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagtagttttattacgccacggcgaaagtatctggaataaagaaaatcgtttt
accggctggacagatgttgatctttctgaaaaaggaaaggaagaagcaaaaaaagcaggc
gaagtacttaaatccgaaggttatactttcgatatcgcatacacttcggtattgaaaaga
gcaatcagaacattatggattgttcttgatgaaatggatttaatgtggattcccgttatc
cgccattggagattgaatgaaagacattatggtgcattacagggtttgaataaagcagaa
accgcgaaaaaatatggtgaagagcaagtaaaaatctggcgaagaagttatgacatccaa
ccacctgctttggaaaaatctgatccaagatatcctggacacgatccaaggtacaaagat
ctttcagaatcagaattacctcttactgaatgtctgaaagatactgtagctcgctttgta
ccttattgggaaggaaccattgcaccaatggtaaaatctggtaaaaaagttttgattact
gctcacggaaacagcttacgggcattagtaaaatatcttgataacatccctgataatgaa
attgttgagttgaacattccaacaggaattcctctggtttatgaactggatgaaaatctt
aaaccaataaaacattattaccttggtaatcccgaagagattgaaaaagctgctgcagca
gtcgctgctcaagcaaaagttaaatag

DBGET integrated database retrieval system