KEGG   Ignavibacterium album: IALB_2926Help
Entry
IALB_2926         CDS       T01943                                 

Gene name
gpm
Definition
(GenBank) Phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ial  Ignavibacterium album
Pathway
ial00010  Glycolysis / Gluconeogenesis
ial00260  Glycine, serine and threonine metabolism
ial00680  Methane metabolism
ial01100  Metabolic pathways
ial01110  Biosynthesis of secondary metabolites
ial01120  Microbial metabolism in diverse environments
ial01130  Biosynthesis of antibiotics
ial01200  Carbon metabolism
ial01230  Biosynthesis of amino acids
Module
ial_M00002  Glycolysis, core module involving three-carbon compounds
ial_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ial00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IALB_2926 (gpm)
  Energy metabolism
   00680 Methane metabolism
    IALB_2926 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    IALB_2926 (gpm)
Enzymes [BR:ial01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     IALB_2926 (gpm)
Membrane trafficking [BR:ial04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    IALB_2926 (gpm)
Exosome [BR:ial04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   IALB_2926 (gpm)
  Exosomal proteins of melanoma cells
   IALB_2926 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFH50629
UniProt: I0ANS2
Position
3326312..3327058
Genome map
AA seq 248 aa AA seqDB search
MYKVVLLRHGESIWNKENRFTGWTDVDLSEKGKEEAKKAGEVLKSEGYTFDIAYTSVLKR
AIRTLWIVLDEMDLMWIPVIRHWRLNERHYGALQGLNKAETAKKYGEEQVKIWRRSYDIQ
PPALEKSDPRYPGHDPRYKDLSESELPLTECLKDTVARFVPYWEGTIAPMVKSGKKVLIT
AHGNSLRALVKYLDNIPDNEIVELNIPTGIPLVYELDENLKPIKHYYLGNPEEIEKAAAA
VAAQAKVK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagtagttttattacgccacggcgaaagtatctggaataaagaaaatcgtttt
accggctggacagatgttgatctttctgaaaaaggaaaggaagaagcaaaaaaagcaggc
gaagtacttaaatccgaaggttatactttcgatatcgcatacacttcggtattgaaaaga
gcaatcagaacattatggattgttcttgatgaaatggatttaatgtggattcccgttatc
cgccattggagattgaatgaaagacattatggtgcattacagggtttgaataaagcagaa
accgcgaaaaaatatggtgaagagcaagtaaaaatctggcgaagaagttatgacatccaa
ccacctgctttggaaaaatctgatccaagatatcctggacacgatccaaggtacaaagat
ctttcagaatcagaattacctcttactgaatgtctgaaagatactgtagctcgctttgta
ccttattgggaaggaaccattgcaccaatggtaaaatctggtaaaaaagttttgattact
gctcacggaaacagcttacgggcattagtaaaatatcttgataacatccctgataatgaa
attgttgagttgaacattccaacaggaattcctctggtttatgaactggatgaaaatctt
aaaccaataaaacattattaccttggtaatcccgaagagattgaaaaagctgctgcagca
gtcgctgctcaagcaaaagttaaatag

DBGET integrated database retrieval system