KEGG   Idiomarina loihiensis L2TR: IL0245Help
Entry
IL0245            CDS       T00218                                 

Gene name
mutM
Definition
formamidopyrimidine DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ilo03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
259672..260484
Genome map
AA seq 270 aa AA seqDB search
MPELPEVEVSRLGISPHIEGRTIKSVKVHDKRLRWPVPETVHKVEGHVLRSVSRRSKYLL
LQTDNGCLILHLGMSGKLRVVPAETTHYKHDHIDIEFDNGQTLRLNDPRRFGALLYSESD
VSGHELLSQLGPEPLTDAFNIDYLFERSRGRSQSVKTFLMDNKVVVGVGNIYANEALFKA
GINPKRAAGKISKVRYQKLVPIIKETLASAIELGGTTLKDFTQVDGNPGYFAQKLQVYGR
GGKLCMVCSNRLKEVRLGQRSTVYCTQCQR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccagagttacccgaagttgaagtcagccgtttaggcatttctccacacattgaaggc
cgcacaattaagtcggttaaggttcacgataagcgcctgcgctggccagtccctgaaact
gtgcacaaggttgaagggcatgttttgcgttcggttagccgccgttcaaaatatttgttg
ttgcagacagataatggctgtctgatattgcatttgggtatgtcgggtaagctgcgtgtg
gttccagccgaaacgactcactacaaacatgaccatattgatattgagttcgataacggg
caaaccctgcgtttaaatgatccgcggcgttttggtgctttgctatatagtgagagtgat
gtaagcgggcatgaactgctaagccagcttggcccggaaccgttaaccgacgcgtttaat
atcgactatttatttgagcgctcacgcgggcgttcgcagtcggtgaaaacctttcttatg
gataataaagtggtcgtgggtgttggcaatatttacgcgaacgaagccttgtttaaggcg
ggtatcaacccgaaacgggcggccgggaaaatcagtaaagtgcgctaccagaaactggtg
ccgataataaaagaaactctggcaagtgctattgaactgggtggtactaccttaaaagat
tttactcaggtggacggtaacccgggctatttcgctcagaaacttcaggtttacgggcgt
ggcggtaagctttgcatggtgtgcagtaaccggttgaaagaagttcgtctgggtcagcgc
agcaccgtgtactgcacccagtgccagcgctag

DBGET integrated database retrieval system