KEGG   Isoptericola variabilis: Isova_1308Help
Entry
Isova_1308        CDS       T01520                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
iva  Isoptericola variabilis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Isova_1308
  Amino acid metabolism
   00340 Histidine metabolism
    Isova_1308
Enzymes [BR:iva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Isova_1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1429571..1430896
Genome map
AA seq 441 aa AA seqDB search
MIQRIDLRGRQLSRKELLGVLPRAEVGVDQAVDAVAPILEDVRRRGAAALRDVAERFDGV
RPADLRVPAAALDDALATLDAGVRAGLEEAIRRVRRVHAEQRPVEHTTTLADGAQVRQRW
IPVQRVGLYAPGGLAVYPSSVVMNVVAAQEAGVPGLAVASPPQKDNGGLPHPTILAACAL
LGVDEVYAVGGAQAVAMFAYGADGSEPQDGEVLCEPVDVVTGPGNVYVAAAKRLVRGVVG
IDAEAGPTEIAVLADDTADAGHVALDLISQAEHDPMAASVLVTPSVELAAAVEARLADLA
DATKHAVRVTQALGGPQSAVVLVDDVEHGLEVVDAYGAEHLEIQTADAAALAERVRSAGA
IFVGPWSPVSLGDYMAGSNHVLPTGGSAHFASGLGVHSFLKSVQVVEYTREALEEVADRI
VAVANDEDLPAHGEAVRGRLQ
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgatccagcgcatcgaccttcgcggccgtcagctctcgcgcaaggagctgctcggcgtg
ctcccacgcgccgaggtcggcgtcgaccaggcggtcgacgccgtcgccccgatcctcgag
gacgtccgccgtcgcggcgccgccgccctgcgcgacgtcgccgagcggttcgacggcgtg
cgcccggccgacctgcgggttccggccgccgcgctcgacgacgccctcgcgacactcgac
gccggcgtgcgggcggggctcgaggaggcgatccgccgcgtgcggcgcgtgcacgccgag
cagcggcccgtcgagcacacgacgacgctcgccgacggcgcccaggtgcgccagcgctgg
atccccgtgcagcgcgtggggctctacgcgcccggcgggctcgcggtgtacccgtcgtcg
gtcgtcatgaacgtggtcgcggcgcaggaggcgggcgtgcccggcctcgccgtggcgtcg
ccgccgcagaaggacaacggcggcctgccgcacccgacgatcctcgcggcgtgcgcgctg
ctcggcgtggacgaggtctacgcggtgggcggcgcccaggcggtggccatgttcgcctac
ggcgccgacgggagcgagccgcaggacggcgaggtgctgtgcgagccggtcgacgtcgtc
acgggtcccggcaacgtctacgtcgccgccgccaagcggctcgtgcgcggcgtcgtgggc
atcgacgccgaggcgggcccgaccgagatcgccgtgctcgcggacgacacggccgacgcc
ggtcacgtcgcgctcgacctcatcagccaggcggagcacgaccccatggccgcctcggtg
ctcgtgacgccgtcggtcgagctggcggcggccgtcgaggcgcggctcgccgacctcgcg
gacgcgaccaagcacgcggtgcgcgtgacccaggcgctcggcggcccgcagtcggcggtc
gtgctggtcgacgacgtcgagcacggcctcgaggtcgtcgacgcgtacggcgcggagcac
ctcgagatccagacggcggacgccgcggcgctcgcggagcgggttcgatcggccggggcg
atcttcgtcggcccgtggtccccggtgtcgctcggcgactacatggccggctcgaaccac
gtgctgccgaccggcggctcggcgcacttcgcgagcgggctcggcgtgcactcgttcctc
aagtccgtgcaggtcgtcgagtacacgcgcgaggcgctcgaggaggtcgccgaccggatc
gtcgcggtggcgaacgacgaggacctgcccgcgcacggcgaggccgtccggggccggctg
cagtag

DBGET integrated database retrieval system