KEGG   Jannaschia sp. CCS1: Jann_0873Help
Entry
Jann_0873         CDS       T00330                                 

Definition
class II aldolase/adducin-like protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
jan  Jannaschia sp. CCS1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Jann_0873
Enzymes [BR:jan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Jann_0873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
829185..829913
Genome map
AA seq 242 aa AA seqDB search
MPDPYYASVDDLKQELVHGFRAMALNDLGLGLLAHLTARMPGADTYWTYQIGQSVEEVRL
SDLREVGFDAKAVDGTSPINPSILCHGDVYRARPDITCILHHHSKASIALGAIGANLAPI
DRNSGRWHDEINIVEDFDAPEIANQGTSMVDALGSGKALILKHHGALVTGRNIRETVVAA
AELDRAMEVQLMAMGAGTPAEIPQAEIDDCKKFLASDMFADGTWNWYMRTMARRGLLDGA
SE
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatccctattacgcctctgtcgatgatctgaaacaggagctggtccacggtttc
cgcgccatggcactgaacgatctgggccttggccttctggcgcatctgaccgcgcggatg
ccgggggcggacacgtattggacgtatcagatcggccaatccgtcgaagaggtccggttg
agtgatctgcgagaggtcgggttcgatgccaaggcggtggatgggacaagcccgatcaat
ccgtccatcctgtgccacggcgatgtctaccgcgcgcggcccgatatcacctgcatcctg
caccaccattcgaaggcgtccattgccctgggcgcgatcggcgcaaacctggcacccatc
gaccgaaactcaggccgctggcatgatgagattaacatcgtggaagacttcgacgcgccc
gagattgccaatcaaggcacgtccatggtggacgcgcttgggtccggcaaggcgctgatc
ctgaaacaccacggggccctggtcaccggccgcaacatccgcgaaaccgtcgtcgcagcg
gccgagttggaccgcgcgatggaggtgcaactgatggccatgggcgcaggcaccccggcc
gagatcccgcaggccgagatcgacgattgcaagaaattcctcgcctctgacatgttcgcg
gacggcacctggaactggtatatgcgtacgatggcacgccggggccttctggacggcgcg
tctgagtga

DBGET integrated database retrieval system