KEGG   Jannaschia sp. CCS1: Jann_3683Help
Entry
Jann_3683         CDS       T00330                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
jan  Jannaschia sp. CCS1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Jann_3683
Enzymes [BR:jan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Jann_3683
Exosome [BR:jan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Jann_3683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3764414..3765883)
Genome map
AA seq 489 aa AA seqDB search
MTQILAIDQGTTSTRAIVFDGQLRPKASAQKEFTQHFPASGWVEHDPNEIWDTVLETCRG
ALDQGGDVAAIGITNQRETVVVWDRHTGEVVYNAIVWQDRRTADLCARLKAEGREPMIQQ
KTGLLLDPYFSGTKLAWILDNVEGARTRAEDGDLAFGTIDSFLIWRMTDGQRHVTDATNA
ARTLLYNIRDGGWDPAICAMLKIPMGILPEVLDCGADFGETSLFGAPLPILGVAGDQQAA
TVGQACFQPGMLKSTYGTGCFALLNTGDTLVTSQNRMLGTIAYQFDGKPTYALEGSIFIA
GAVVQWLRDGLKIIDDAPQSAGLADAADATQSLYLVPAFTGLGAPYWDPDARGAIYGLTR
NSGPAEIAKAALESVGFQTRDLLEAMAADYPGDTGNVRVDGGMTASDWTMQFLSDILGAP
VDRPQVLETTAVGAAWIAGNRAGLYPDQDGFAASWALDTTFEPQMDAATRDARYAGWKDA
VARTLSDHG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacccagatcctcgccatcgaccagggcaccacctccacccgtgcaatcgtctttgat
gggcagttgcggccaaaagccagcgcccagaaggaattcacgcagcatttcccggcatcc
ggctgggtggagcatgatcccaatgagatctgggatacggtgctggaaacctgccggggc
gctttggatcagggcggggacgttgcggccatcggcatcaccaaccagcgcgaaacggtt
gtggtctgggaccggcacacgggggaggtcgtctacaatgccatcgtctggcaggatcgc
cgcacggcggatctgtgcgcccggttgaaggccgaggggcgtgaaccgatgatccagcag
aagaccggcctgctgctggacccctatttcagcgggacgaaactggcctggattctcgac
aacgtcgagggtgcgcggacccgggcggaggacggggatctggcgtttggcaccatcgac
agcttccttatctggcgtatgaccgacggccagcgccacgtgaccgatgccacgaacgcg
gcccgcacgctgctctacaatattcgcgatggcggatgggatccggccatttgcgccatg
ctcaagatccccatgggtatcctgcccgaggttctcgattgcggtgccgattttggagag
acctcgctgttcggcgcgccgctgccgatccttggcgtcgcaggcgaccaacaggccgcc
accgtggggcaggcatgtttccagccgggcatgttgaaatcgacctatggcaccgggtgt
ttcgcgctgctgaacacgggcgacacgctggtgacgtcgcaaaaccggatgctggggacg
attgcctatcagtttgacggcaagccgacctatgcgctggagggctccatcttcatcgcg
ggtgcggtggtccaatggctgcgcgacgggctaaagatcatcgacgatgcgccgcagagt
gccgggctggcggacgcggcagatgccacgcagtccctttacctcgtgcccgcgttcacc
ggccttggcgcgccctactgggacccggacgcgcgcggcgcgatatacgggctgacgcgc
aattcaggccccgcggaaattgccaaagccgcgttggaatcggtgggtttccagacccgc
gatttgttggaggcgatggcggcggattaccccggcgatacgggcaatgttcgggtggac
ggcggcatgaccgcctctgactggacgatgcaattcctcagcgacatcctcggtgcgcca
gtggatcgcccgcaggtgctggagacgacagccgtcggcgcggcctggatcgcgggcaac
cgtgcgggcctttacccggaccaagacggcttcgccgcgtcctgggcgctggacacaacg
ttcgagccgcagatggacgctgccacacgcgacgcacgatatgcgggctggaaggacgcc
gtcgcacgaacgttgtccgaccatggataa

DBGET integrated database retrieval system