KEGG   Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis): CKBE_00567Help
Entry
CKBE_00567        CDS       T02427                                 

Definition
hypothetical protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
kbl  Candidatus Kinetoplastibacterium blastocrithidii (ex Strigomonas culicis)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:kbl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CKBE_00567
   00240 Pyrimidine metabolism
    CKBE_00567
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CKBE_00567
   03430 Mismatch repair
    CKBE_00567
   03440 Homologous recombination
    CKBE_00567
Enzymes [BR:kbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CKBE_00567
DNA replication proteins [BR:kbl03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CKBE_00567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
635412..635858
Genome map
AA seq 148 aa AA seqDB search
MEINFIFGIKKRMDAVCQIINGYYLNKRRVVVYSNEYDILCKLNIMLWTFKDVSFIPHSF
YQKKNNCEEEYIIISDYLSQTSHIKNNEMLLVNMSNILPLCYNDFDCVVEIVTEDEQERS
EARSRWRTYKNDGHILTSCHFNDLVFSK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaattttatttttggaataaaaaaaaggatggatgctgtctgtcaaataata
aatggatactatctaaataaaaggagagtagttgtatattctaacgaatatgatatttta
tgcaaactaaatataatgttatggactttcaaagacgtatcttttataccacactcattc
tatcaaaaaaaaaacaattgcgaagaggaatatataattatttctgattatctatcacaa
acaagccacataaaaaacaatgagatgttgttggttaacatgtctaatatcttacccttg
tgttataatgactttgattgtgtcgtagagatagtaacagaagatgaacaagagcgcagt
gaggctaggtctagatggaggacttataaaaatgatggtcatatattgacaagttgtcat
tttaatgatttagtcttttctaaatag

DBGET integrated database retrieval system