KEGG   Candidatus Korarchaeum cryptofilum: Kcr_0934Help
Entry
Kcr_0934          CDS       T00668                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kcr  Candidatus Korarchaeum cryptofilum
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kcr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Kcr_0934
   00650 Butanoate metabolism
    Kcr_0934
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Kcr_0934
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Kcr_0934
Enzymes [BR:kcr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Kcr_0934
Amino acid related enzymes [BR:kcr01007]
 Aminotransferase (transaminase)
  Class III
   Kcr_0934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(940707..941993)
Genome map
AA seq 428 aa AA seqDB search
MIESYYPSVFKCKPSFPIVVDRGFKAEIWTKDGRRFLDFSGAATSLGQAHPKVVESIKEH
VNKITGFSGLLAPTEPFLRLGEELKSIVPVRDASIAYATTGSEASDFAIQLAKYVTKRSV
ILSFFGAYHGLTGYALMSSPTEGMRRVAPRVSDTLYAPYPNCLPCKMRSLPCDDCVDLSI
SFIEEEIIGRAVEPEDLAAIIVEPLQSHGGIIFPPARFFQELRRISNETGALLIVDEVYT
GFGRTGKWFGIEHHGVEPDIMVMGKGMGGGLPIAAVAFRGRLLEDWYLCSGGSLGTFAGH
YLSAVASLATIEAIREENLIENAKERGEQLSSSLREFVERYDFLVDSRGTGCVQGIEFYE
KGKPSKKVAEMVKWALFDRGLLAIQVGRHHNVIKLTPPITITEEQMDEAIRIIEDSLNEV
KRVRRDGL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgatagagtcatattatccttctgtattcaaatgcaagccctccttccccatagtagtc
gatagggggttcaaagctgagatatggacgaaggatgggaggaggttcctggacttcagc
ggggctgccacctccttaggtcaggcgcatcccaaggtagtcgagagcatcaaggagcat
gtgaataaaataacaggattctcaggtctattggctccaacggaacccttcttaaggttg
ggtgaggaactgaaatctatagtgcctgtcagggacgcttcaatagcttacgctactaca
ggaagtgaggcgagcgatttcgcgatccagctggctaaatacgtcacgaagaggagcgtc
atcctctcattcttcggggcctatcatggtctgacgggttacgctctgatgtcatcaccg
acggagggaatgaggagagtggcccctagggtcagcgatactctatatgcgccgtacccc
aactgcctcccctgcaagatgagatccctcccatgcgatgattgcgtggatctctcaatc
tcgttcatagaggaggaaataattgggagagctgtcgagccagaggatctcgcggctata
attgtggagcctctacaatcgcatgggggcataatatttccgccagcgaggttcttccaa
gaacttaggaggatatcgaacgagacaggggctctcctgatagtggatgaagtctatacc
ggtttcgggaggacgggaaagtggttcgggatcgagcaccatggcgtcgagcccgatata
atggtaatgggtaaggggatgggcgggggactccccatagctgccgtggccttcaggggg
agactcctagaggactggtacctctgcagtgggggtagcctcgggaccttcgctgggcac
tacctatcggcagtagcttccctggcaactatagaggccataagggaggagaatctgatc
gagaacgccaaggagaggggtgagcagttgagctcatccctcagggagttcgtcgagaga
tatgacttcctggtcgattccagaggaactggatgtgttcagggaatagagttctatgag
aaaggcaaaccttctaagaaagtagctgagatggtgaaatgggctttattcgatcggggt
ctcctagccatccaggtggggaggcatcataacgtgatcaaattgaccccgcccataacg
ataacagaggagcagatggatgaggccataaggattattgaggattcccttaatgaggta
aaaagagttagaagagatggcttatga

DBGET integrated database retrieval system