KEGG   Kribbella flavida: Kfla_6176Help
Entry
Kfla_6176         CDS       T01155                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kfl  Kribbella flavida
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Kfla_6176
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kfla_6176
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Kfla_6176
Enzymes [BR:kfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Kfla_6176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
6621706..6623079
Genome map
AA seq 457 aa AA seqDB search
MTTPTKILLPEDELPTRWYNVLHDLPTPPPPVLHPGTGQPVGPDDLAPLFPMDLILQEVS
QDQYVDIPGEVLDVYRLWRPSPLYRAHRLEKALDTPARIYYKYEGVSPAGSHKPNTAVPQ
AYYNAKAGIRKLTTETGAGQWGTALAFACAQYGLECEVWQVRASYDQKPYRRAMMKVFGA
TVHASPSELTEAGRKILAENPGSTGSLGIAISEAVEMAVQDETVHYALGSVLNHVLMHQT
VIGEEALMQLAMVGETPDLIVGCTGGGSNFGGLAFPFLREKWAGRQSPVVRAVEPEACPS
LTQGTYAYDFGDTAGMTPLMKMHTLGHDFVPDPIHSGGLRYHGMSPLISHLYETGEIEAI
AKPQSECFAAGVLFARTEGIVPAPEPTHALAAAIDEAQRCKESGEEKVILTALCGHGHLD
LAAYDAYLSGAITDRAWDDAELQASVARALERLPAVH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgccgacgaagatcctgctgcccgaggacgagctgcccacccgctggtacaac
gtgctgcacgatctgccgacgcccccgccgccggtgctgcacccgggcaccgggcagccg
gtcgggccggacgacctggcgccgctgttcccgatggacctgatcctgcaggaggtctcg
caggaccagtacgtcgacatcccgggcgaggtgctcgacgtgtaccggctctggcggccg
agcccgctctaccgggcgcaccggctggagaaggcgctcgacaccccggcccggatctac
tacaagtacgaaggcgtctcccccgccgggtcgcacaaaccgaacacggccgtgccgcag
gcctactacaacgccaaggccgggatccggaagctgaccaccgagaccggcgccggccag
tggggcacggcgctggcgttcgcgtgcgcgcagtacgggctggagtgcgaggtctggcag
gtgcgggcgtcgtacgaccagaagccctaccggcgggcgatgatgaaggtgttcggcgcg
accgtgcacgcgagcccgtcggagctgaccgaggccggccgcaagatcctggccgagaac
cccggttccaccggctcgctcggcatcgcgatcagcgaggcggtcgagatggcggtccag
gacgagacggtgcactacgcgctcggctcggtgctcaaccacgtgctgatgcaccagacg
gtcatcggcgaagaggcgttgatgcagctcgcaatggtcggcgagaccccggacctgatc
gtcggctgcaccggcggcggctcgaacttcggcggtctggccttcccgttcctgcgggag
aagtgggccggccggcagtcgccggtggtgcgcgcggtcgagccggaggcgtgcccgtcg
ctcacccagggcacctacgcctacgacttcggcgacaccgccggcatgacgccactgatg
aagatgcacacgctcggccacgacttcgtgccggacccgatccattccggcggcctgcgg
taccacggcatgagcccgctgatcagccacctgtacgagaccggcgagatcgaggcgatc
gccaagccgcagtcggagtgcttcgcggccggcgtgctgttcgcccggaccgagggcatc
gtgccggcgccggagccgacgcatgcgctggccgccgcgatcgacgaggcgcagcggtgc
aaggagtcgggcgaggagaaggtgatcctgaccgcgctgtgcggccacggccacctcgac
ctggccgcgtacgacgcctacctgtccggcgcgatcaccgatcgggcctgggacgacgcc
gagctgcaggcctcggtcgcccgcgcgctcgagcggctgcccgccgtccactaa

DBGET integrated database retrieval system