KEGG   Kribbella flavida: Kfla_6176Help
Entry
Kfla_6176         CDS       T01155                                 

Definition
pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kfl  Kribbella flavida
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Kfla_6176
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kfla_6176
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Kfla_6176
Enzymes [BR:kfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Kfla_6176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6621706..6623079
Genome map
AA seq 457 aa AA seqDB search
MTTPTKILLPEDELPTRWYNVLHDLPTPPPPVLHPGTGQPVGPDDLAPLFPMDLILQEVS
QDQYVDIPGEVLDVYRLWRPSPLYRAHRLEKALDTPARIYYKYEGVSPAGSHKPNTAVPQ
AYYNAKAGIRKLTTETGAGQWGTALAFACAQYGLECEVWQVRASYDQKPYRRAMMKVFGA
TVHASPSELTEAGRKILAENPGSTGSLGIAISEAVEMAVQDETVHYALGSVLNHVLMHQT
VIGEEALMQLAMVGETPDLIVGCTGGGSNFGGLAFPFLREKWAGRQSPVVRAVEPEACPS
LTQGTYAYDFGDTAGMTPLMKMHTLGHDFVPDPIHSGGLRYHGMSPLISHLYETGEIEAI
AKPQSECFAAGVLFARTEGIVPAPEPTHALAAAIDEAQRCKESGEEKVILTALCGHGHLD
LAAYDAYLSGAITDRAWDDAELQASVARALERLPAVH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgccgacgaagatcctgctgcccgaggacgagctgcccacccgctggtacaac
gtgctgcacgatctgccgacgcccccgccgccggtgctgcacccgggcaccgggcagccg
gtcgggccggacgacctggcgccgctgttcccgatggacctgatcctgcaggaggtctcg
caggaccagtacgtcgacatcccgggcgaggtgctcgacgtgtaccggctctggcggccg
agcccgctctaccgggcgcaccggctggagaaggcgctcgacaccccggcccggatctac
tacaagtacgaaggcgtctcccccgccgggtcgcacaaaccgaacacggccgtgccgcag
gcctactacaacgccaaggccgggatccggaagctgaccaccgagaccggcgccggccag
tggggcacggcgctggcgttcgcgtgcgcgcagtacgggctggagtgcgaggtctggcag
gtgcgggcgtcgtacgaccagaagccctaccggcgggcgatgatgaaggtgttcggcgcg
accgtgcacgcgagcccgtcggagctgaccgaggccggccgcaagatcctggccgagaac
cccggttccaccggctcgctcggcatcgcgatcagcgaggcggtcgagatggcggtccag
gacgagacggtgcactacgcgctcggctcggtgctcaaccacgtgctgatgcaccagacg
gtcatcggcgaagaggcgttgatgcagctcgcaatggtcggcgagaccccggacctgatc
gtcggctgcaccggcggcggctcgaacttcggcggtctggccttcccgttcctgcgggag
aagtgggccggccggcagtcgccggtggtgcgcgcggtcgagccggaggcgtgcccgtcg
ctcacccagggcacctacgcctacgacttcggcgacaccgccggcatgacgccactgatg
aagatgcacacgctcggccacgacttcgtgccggacccgatccattccggcggcctgcgg
taccacggcatgagcccgctgatcagccacctgtacgagaccggcgagatcgaggcgatc
gccaagccgcagtcggagtgcttcgcggccggcgtgctgttcgcccggaccgagggcatc
gtgccggcgccggagccgacgcatgcgctggccgccgcgatcgacgaggcgcagcggtgc
aaggagtcgggcgaggagaaggtgatcctgaccgcgctgtgcggccacggccacctcgac
ctggccgcgtacgacgcctacctgtccggcgcgatcaccgatcgggcctgggacgacgcc
gagctgcaggcctcggtcgcccgcgcgctcgagcggctgcccgccgtccactaa

DBGET integrated database retrieval system