KEGG   Klebsiella oxytoca E718: A225_4182Help
Entry
A225_4182         CDS       T02173                                 

Definition
aspartate/tyrosine/aromatic aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
koe  Klebsiella oxytoca E718
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:koe00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    A225_4182
   01230 Biosynthesis of amino acids
    A225_4182
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A225_4182
   00290 Valine, leucine and isoleucine biosynthesis
    A225_4182
Enzymes [BR:koe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     A225_4182
    2.6.1.66  valine---pyruvate transaminase
     A225_4182
Amino acid related enzymes [BR:koe01007]
 Aminotransferase (transaminase)
  Class I
   A225_4182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4420823..4422040
Genome map
AA seq 405 aa AA seqDB search
MSPIEKSSKLDNVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYSDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVALSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDEAQHHSIAPLAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
VPGGRLYEQRNRAWELINDIPGVSCTKPKGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHVRIVTLPREDDLEMAITRFGRFLSGYHQL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccatcgaaaaatccagcaagttagataacgtctgttacgacatccgcggcccg
gttctgaaagaggcgaaacgccttgaagaagaaggcaataaagtcctgaagctgaacatc
ggcaacccagcgccgtttggctttgacgcgcctgacgagatcctcgttgacgttatccgc
aacctccctacctcgcagggctacagcgattcaaaaggcctctattccgcccgtaaggcc
atcatgcagcattaccaggcccgcggtatgcgtgatgtgacggtcgaagatatctatatt
ggtaacggcgtttcggagcttatcgtccaggccatgcaggcgctgctgaacagcggcgat
gaaatgctggtcccggcgccggattatccgctgtggaccgccgcggtcgcgctttccagc
ggtaaagcggtgcactatctttgcgatgagtcttccgactggttcccggacctcgacgat
atccgcgcgaaaatcaccccgcgtacccgcggcatcgtgattatcaacccgaataaccca
accggcgcggtgtactcaaaagagctgctgatggagatcgtcgagatcgcccgccagcat
aacctgattattttcgccgatgagatctacgataagatcctctacgatgaagcgcagcac
cactcaattgcgccgctggccccggatctgctcaccgttacctttaacggcctgtcaaaa
acctaccgcgttgccggcttccgccagggttggatggtactgaacgggccgaagaaacac
gcaaaaggctatatcgaaggcctggagatgctggcctctatgcgcctgtgcgccaacgtc
ccggcccagcatgcgatccaaaccgctctcggcggctatcagagcatcagcgaatttatt
gttcccggcggacgcttgtatgaacagcgtaatcgcgcctgggagctgattaacgacatt
ccgggcgtctcgtgcactaagccgaaaggcgcgctgtatatgttcccgaaaatcgacgct
aaacgctttaatattcacgatgaccagaagatggtgctcgattttctgctgcaggagaaa
gtcctgctggttcagggtaccgcctttaactggccgtggccggaccacgtgcgtattgtg
acccttccgcgcgaagacgatcttgaaatggcaattacccgtttcgggcgtttcctttcc
ggctaccaccagctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system