KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_03480Help
Entry
KPHS_03480        CDS       T01733                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KPHS_03480
  Lipid metabolism
   00561 Glycerolipid metabolism
    KPHS_03480
   00600 Sphingolipid metabolism
    KPHS_03480
Enzymes [BR:kpm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     KPHS_03480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
387335..388687
Genome map
AA seq 450 aa AA seqDB search
MSAPKITFIGAGSTVFVKNILGDVFQRPALKSAHIALMDIDETRLEESHIVVRKLMDSVG
ANGEISCHRDRKTALQGADFVVVAFQIGGYEPCTVTDFAVCKRHGLEQTIADTLGPGGIM
RALRTIPHLWAICDDMSEVCPDATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTAE
ELARDLDLDPADLRYRCAGINHMAFYLSLEKKLADGSYVSIYPDLLQAYADGRAPKPNLH
GNPRCENIVRYEMLKKLGYFVTESSEHFAEYTPWFIKPGRDDLLARYKVPLDEYPKRCVE
QLANWHQELESYKRGERIGVKPSREYASTIMNAIWTGEPSVVYGNVRNDNLIDNLPQGCC
VEVACLVDANGIQPTKVGALPAHLAALMQTNINVQTLLTQAILTENRDYVYYATMMDPHT
AAVLGIEEIYALVDDLIASHGDWLPAWLHR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccccaaaaattacttttatcggcgccggttcgacggtgttcgtcaaaaatatt
ctcggtgatgttttccagcgcccggcgctgaaatcggcgcatatcgcgctgatggatatc
gatgaaacccggctggaagagtcgcatatcgtggtgcgcaagctgatggattccgtgggc
gcgaacggcgaaatcagttgccaccgcgaccggaaaaccgccctgcagggcgccgatttt
gtcgtcgttgccttccagattggcggctatgagccctgtaccgtcaccgattttgcagtc
tgcaagcgccacggcctggagcagaccattgccgatacgctggggccgggaggcattatg
cgcgcgctgcgcaccatcccgcacctgtgggctatctgcgacgatatgagcgaggtctgc
ccggacgccaccatgcttaactacgtcaacccgatggcgatgaacacctgggcgatgtac
gcccgctacccgcatatcaagcaggtgggtctgtgccactcggtgcaaggcacagcggaa
gaactggcgcgcgacctcgatctcgatccggcggatttacgctaccgctgcgcggggatt
aaccatatggcgttctatctgtcgctggagaaaaagctcgcggacggcagctacgtcagt
atctaccccgacctgctacaggcctacgccgacgggcgggcgccgaagccgaacctgcac
ggcaacccgcgctgcgaaaacatcgtccgctatgaaatgctcaaaaagctgggctacttt
gtcaccgagtcctcggagcatttcgccgaatacacgccatggtttatcaagccgggccgc
gatgaccttctcgctcgctataaagtgccgctggatgaataccctaaacgctgcgtcgag
caactggccaactggcatcaggagctggagagctataagcgcggggagcgcattggggtg
aaaccctcccgcgaatatgccagcaccatcatgaacgccatctggaccggcgagccaagc
gtggtgtacggcaacgtgcgcaacgataatctcatcgacaacctgcctcagggctgctgt
gtggaagtggcctgcctggtggacgccaacggcatccagccgaccaaagtgggcgcgctg
ccggcgcatctggcggcgctgatgcagaccaatatcaacgtgcagacgctgctcacgcag
gcgatcctcaccgaaaatcgcgattacgtctattacgccacgatgatggatccgcacacc
gccgcggtgctggggatcgaagagatctacgcgctggtggacgatctgatcgccagccac
ggcgactggctgccggcctggctgcaccgttaa

DBGET integrated database retrieval system