KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_06515Help
Entry
KPN2242_06515     CDS       T01982                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPN2242_06515
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPN2242_06515
  Amino acid metabolism
   00310 Lysine degradation
    KPN2242_06515
Enzymes [BR:kpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KPN2242_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1382679..1383905
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGATVLSRQILGRLREGNSAGKESSEKADAKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLDPAAIKGTGVGGRLTREDVEKHLAKAPAPAEAKAPAAAPAAAPAPQLGHRSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSF
YVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDLLGMADIEK
NIKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VNGKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggttcccgacctgcctgagtccgtagctgacgcaaccgtc
gccacctggcacaaaaaaccgggcgacgcggtcgtccgtgacgaagttctggtcgaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcggacggcattctggatgcagtg
ctggaagacgagggcgccaccgtcctgtctcgccagatccttggccgcctgcgcgaaggc
aacagcgcaggtaaagaaagcagcgagaaagccgatgcgaaagcgtccactccggcgcag
cgtcagcaggcctctctggaagagcagaacaacgacgcgctgagcccggcgatccgtcgt
ctgctggctgaacacaaccttgacccagcggccatcaaaggcactggcgtcggcggccgt
ctgacccgcgaagacgttgagaaacatctggcgaaagccccggcgccggcagaagccaaa
gcgccagccgccgccccggcagccgcgccggcgccgcagctgggccaccgttcggaaaaa
cgcgtcccgatgacccgcctgcgtaaacgcgtagccgaacgtctgctggaagcgaaaaac
tctaccgccatgctgacgacctttaacgaagtcaacatgaagcccatcatggatctgcgt
aagcagtacggtgaggcgttcgaaaaacgtcatggcatccgcctgggctttatgtccttc
tacgtgaaagcggtagtggaagcgctgaaacgctatccggaagtgaacgcttccatcgat
ggcgacgacgtggtgtaccacaactacttcgacgtcagcatggccgtatccactccgcgc
ggtctggtcaccccggttctgcgtgacgtcgacctgctgggcatggcggatatcgaaaag
aatatcaaagagctggcagtgaaaggccgcgacggcaagctgaccgtagacgacctgacc
ggcggtaacttcactattaccaacggcggcgtcttcggctccctgatgtccacgccgatc
atcaacccaccgcagagcgctattctgggtatgcatgccattaaagaccgtccgatggcg
gtcaatggcaaggtagagatcctgccgatgatgtacctggcgctctcctatgaccaccgt
ctgatcgacggacgtgaatcggtaggcttcctggtggcgattaaagagctgctggaagat
ccgacccgtctgctgctggacgtgtag

DBGET integrated database retrieval system