KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_14195Help
Entry
KPN2242_14195     CDS       T01982                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00900  Terpenoid backbone biosynthesis
kpo01100  Metabolic pathways
kpo01110  Biosynthesis of secondary metabolites
kpo01130  Biosynthesis of antibiotics
Module
kpo_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPN2242_14195 (ipk)
Enzymes [BR:kpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     KPN2242_14195 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEJ98729
Position
2950150..2951001
Genome map
AA seq 283 aa AA seqDB search
MMTRWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLTIEPRTDGQLRLLTPVAGV
PDEENLIVRAARLLMHAASESDRLPAGSGADISIDKRLPMGGGLGGGSSNAATVLVALNH
LWGCGLSEDELATLGLQLGADVPVFVRGHAAFAEGVGEILTPVEPEEKWYLVAHPGVSIP
TPIIFRDPELPRNTPRRSINTLLNCEFSNDCELIARKRFREVDAALSWLLEYAPSRLTGT
GACVFAEFNTESAARQVLDTAPAWLNGFVARGVNLSPLKQALL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatgacccgctggccctctcctgcaaaactgaatctgtttttatatatcaccggccag
cgggccgatggttaccataccctgcaaacgctgtttcagtttctcgattacggcgatacg
ttgaccatcgaaccgcgtactgacggccaactgcgcctgctgacgccggtggccggcgtg
ccggacgaggagaatctgatcgttcgcgccgcgcgtctgctgatgcatgccgccagcgaa
agcgatcgcctgccggcgggcagcggcgccgatatcagtatcgataagcgcctgccgatg
ggcggcggcctgggcggtggctcctccaatgctgccaccgtgctggtggcgctcaaccat
ctgtggggctgcggtctctcggaagatgagctggcgactcttggccttcagctgggggcc
gatgtgccggttttcgtgcgcggccatgccgccttcgccgagggggtgggtgaaatactg
acgccggtagaacccgaggaaaaatggtacctggtggcccacccgggggtcagtattccg
acgccgatcatttttcgcgatccggagctaccacgaaataccccgcgccggtcaattaat
acgttattaaattgtgaattcagcaacgattgcgagcttatcgcaagaaaacgttttcgc
gaggttgatgccgcgctttcctggctgttagaatatgcgccgtcacgcctgaccggcaca
ggggcctgtgtgtttgctgaatttaacaccgaatccgctgcccgtcaggtgctggacact
gccccggcatggctaaatggctttgtggcgcgcggagttaacctttcgccgctcaagcag
gccctgctctga

DBGET integrated database retrieval system