KEGG   Kytococcus sedentarius: Ksed_12720Help
Entry
Ksed_12720        CDS       T00974                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
kse  Kytococcus sedentarius
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ksed_12720
Enzymes [BR:kse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Ksed_12720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1313216..1313821
Genome map
AA seq 201 aa AA seqDB search
MSTGGADGRRLVVLAGPTAVGKGTVCQWVRDNHPEVWVSVSATTRAPRPGEVDGSTYHFV
DHDEFSRLVATGQMLEHAVVHGVNSYGTPRRPVEQALADGRPALLEIDLQGARQVREAMP
EALFVFLAPPSWDELVRRLVGRGTEDAEERARRLRTAQDELAAQDWFDTTIVNESVAAAG
ENLVELLLDPPPVPADRRVTP
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgggcggggccgacggtcggcggctggtggtgctggccggcccgacggcggtc
ggcaagggcaccgtgtgccagtgggtgcgggacaaccaccccgaggtgtgggtgtcggtc
tcggccaccacccgcgccccgcggcccggcgaggtcgacgggtccacgtaccacttcgtg
gaccacgacgagttctcgcggctggtcgccaccgggcagatgctggagcacgcggtggtg
cacggggtgaactcctacggcacgccgcgccgcccggtggagcaggccctggccgacggc
cggcccgcgctgctggagatcgacctgcagggtgcccggcaggtgcgtgaggccatgccc
gaggccctgttcgtcttcctggcgcccccgagctgggacgagctggtgcgccggctggtc
ggacgcggcaccgaggacgccgaggagcgggcccgccggctgcgcacggcacaggacgag
ctggccgcccaggactggttcgacaccaccatcgtcaacgagtcggtcgccgccgccggt
gagaacctcgtagaattgctgctcgacccgccgccggtccccgcagaccgccgcgtcacc
ccctga

DBGET integrated database retrieval system