KEGG   Kitasatospora setae: KSE_52970Help
Entry
KSE_52970         CDS       T01648                                 

Gene name
dxr
Definition
(GenBank) putative 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ksk  Kitasatospora setae
Pathway
ksk00900  Terpenoid backbone biosynthesis
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01130  Biosynthesis of antibiotics
Module
ksk_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KSE_52970 (dxr)
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     KSE_52970 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: BAJ31073
NITE: KSE_52970
UniProt: E4NHU3
Position
5882496..5883725
Genome map
AA seq 409 aa AA seqDB search
MNSLAHPQSRFTPVVRDQDGPRELVILGSTGSIGTQAIDVVLRNPDRFRVVALSAAGGRV
ELLAEQALALGVRTVAVADPAAEGPLRAALAARAGGAPLPEVLAGPDAATELAATECHSV
LNGITGSIGLAPTLAALRAGRVLVLANKESLIVGGPLVKAVARPGQIVPVDSEHAALFQA
LAGGTRAEVRKLVVTASGGPFRTRSRGQLAGVTPAEALAHPTWAMGPVVTINSATLVNKG
LEVIEAHLLYDVPFDRIEVVVHPQSIVHSMVEFTDGSTLAQASPPDMRMPIALGLGWPDR
VPDAAPGCDWTKAATWEFFPLDDEAFPAVELAREVGTLGGTAPAVFNAANEECVDAFLKG
ALPFTGIVDTVAKVVAEHGTPAAGTSLTVEDVLHAEHWARARARELAAG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgctcgcccatccgcagtcgcgcttcactccggtcgtccgggaccaggacggc
ccccgggagctggtcatcctgggctcgaccggctcgatcggcacccaggccatcgacgtg
gtgctccgcaaccccgaccggttccgggtggtcgcgctgtccgcggccggcggccgggtg
gagctgctcgccgagcaggcgctcgcgctgggcgtgcgcaccgtcgcggtggccgacccg
gccgccgaggggccgctgcgcgccgcgctggccgcgcgggccggcggcgccccgctgccc
gaggtgctggccggcccggacgcggcgaccgagctggcggcgaccgagtgccactcggtg
ctgaacggcatcaccggctcgatcggcctggcgccgacgctggccgcgctgcgggccggc
cgggtgctggtgctggccaacaaggagtcgctgatcgtcggcggcccgctggtcaaggcg
gtggcccggccgggccagatcgtgccggtggactccgagcacgccgcgctgttccaggcg
ctggccggcggcacccgggccgaggtccgcaagctggtggtgaccgccagcggcggcccg
ttccgcacccggagccgcgggcagctggccggggtcaccccggcggaggcgctggcgcac
ccgacctgggcgatgggcccggtggtgacgatcaactcggcgaccctggtgaacaagggc
ctggaggtgatcgaggcgcacctgctctacgacgtgcccttcgaccggatcgaggtcgtc
gtccacccgcagtcgatcgtccattcgatggtggagttcacggacggctcaacgctcgcc
caggccagcccgccggacatgcggatgccgatcgcgctcggcctcggctggcccgaccgg
gtcccggacgccgcacccggctgcgactggaccaaggccgcgacctgggagttcttcccg
ctggacgacgaggccttccccgccgtcgagctcgcccgggaggtgggtacgctcggcggg
acggcccccgcggtcttcaacgccgcgaacgaggaatgtgtggacgctttcctgaagggc
gcactgcccttcaccggaatcgtggacactgtggcgaaggtggtcgccgaacacggcacc
ccggcggcgggaacctcgctcaccgtggaggacgtactccacgcggagcactgggcccgc
gcccgggcccgggaactggcggcaggttag

DBGET integrated database retrieval system