KEGG   Kitasatospora setae: KSE_52970Help
Entry
KSE_52970         CDS       T01648                                 

Gene name
dxr
Definition
putative 1-deoxy-D-xylulose-5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ksk  Kitasatospora setae
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ksk00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
5882496..5883725
Genome map
AA seq 409 aa AA seqDB search
MNSLAHPQSRFTPVVRDQDGPRELVILGSTGSIGTQAIDVVLRNPDRFRVVALSAAGGRV
ELLAEQALALGVRTVAVADPAAEGPLRAALAARAGGAPLPEVLAGPDAATELAATECHSV
LNGITGSIGLAPTLAALRAGRVLVLANKESLIVGGPLVKAVARPGQIVPVDSEHAALFQA
LAGGTRAEVRKLVVTASGGPFRTRSRGQLAGVTPAEALAHPTWAMGPVVTINSATLVNKG
LEVIEAHLLYDVPFDRIEVVVHPQSIVHSMVEFTDGSTLAQASPPDMRMPIALGLGWPDR
VPDAAPGCDWTKAATWEFFPLDDEAFPAVELAREVGTLGGTAPAVFNAANEECVDAFLKG
ALPFTGIVDTVAKVVAEHGTPAAGTSLTVEDVLHAEHWARARARELAAG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgctcgcccatccgcagtcgcgcttcactccggtcgtccgggaccaggacggc
ccccgggagctggtcatcctgggctcgaccggctcgatcggcacccaggccatcgacgtg
gtgctccgcaaccccgaccggttccgggtggtcgcgctgtccgcggccggcggccgggtg
gagctgctcgccgagcaggcgctcgcgctgggcgtgcgcaccgtcgcggtggccgacccg
gccgccgaggggccgctgcgcgccgcgctggccgcgcgggccggcggcgccccgctgccc
gaggtgctggccggcccggacgcggcgaccgagctggcggcgaccgagtgccactcggtg
ctgaacggcatcaccggctcgatcggcctggcgccgacgctggccgcgctgcgggccggc
cgggtgctggtgctggccaacaaggagtcgctgatcgtcggcggcccgctggtcaaggcg
gtggcccggccgggccagatcgtgccggtggactccgagcacgccgcgctgttccaggcg
ctggccggcggcacccgggccgaggtccgcaagctggtggtgaccgccagcggcggcccg
ttccgcacccggagccgcgggcagctggccggggtcaccccggcggaggcgctggcgcac
ccgacctgggcgatgggcccggtggtgacgatcaactcggcgaccctggtgaacaagggc
ctggaggtgatcgaggcgcacctgctctacgacgtgcccttcgaccggatcgaggtcgtc
gtccacccgcagtcgatcgtccattcgatggtggagttcacggacggctcaacgctcgcc
caggccagcccgccggacatgcggatgccgatcgcgctcggcctcggctggcccgaccgg
gtcccggacgccgcacccggctgcgactggaccaaggccgcgacctgggagttcttcccg
ctggacgacgaggccttccccgccgtcgagctcgcccgggaggtgggtacgctcggcggg
acggcccccgcggtcttcaacgccgcgaacgaggaatgtgtggacgctttcctgaagggc
gcactgcccttcaccggaatcgtggacactgtggcgaaggtggtcgccgaacacggcacc
ccggcggcgggaacctcgctcaccgtggaggacgtactccacgcggagcactgggcccgc
gcccgggcccgggaactggcggcaggttag

DBGET integrated database retrieval system