KEGG   Klebsiella variicola: Kvar_1729Help
Entry
Kvar_1729         CDS       T01170                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
kva  Klebsiella variicola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kva00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Kvar_1729
Enzymes [BR:kva01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Kvar_1729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1866713..1867324
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIILEKQPPLVLLETAGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVASLVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPAGPTADDAEQEAVAALVALGYKPQEASRM
VSKIARPDANSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcattctcgaaaaacaacccccgctggtgttgctggaa
acggcgggcgtcggctatgaagtgcatatgccaatgacctgcttctatgagctgccggag
gccggtcaggaggcgatagtctttacccactttgtggtgcgtgaagatgcccagctgctg
tatggttttaacaacaaacaggaacgtacgctgtttaaagagctgattaaaaccaacggt
gtggggccaaagctggcgctggcgatcctctccggcatgtcggcgcagcagttcgtcaat
gccgttgagcgggaagaagtcgcctcgctggtgaagctgccggggattggcaaaaaaacc
gcagaacgcctgatcgtcgagatgaaagaccgtttcaaagggctgcacggcgacctgttc
actccggcggccgatctggtgctgacctcgccggcaggcccgacggcagatgatgccgaa
caggaagcggttgccgcgctggtcgcgctgggctataaaccgcaggaggccagccggatg
gtaagcaagattgcccgtccggacgccaacagtgaaacgctaatccgcgaagcgctgcgc
gccgcgttgtga

DBGET integrated database retrieval system