KEGG   Klebsiella variicola: Kvar_1729Help
Entry
Kvar_1729         CDS       T01170                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
kva  Klebsiella variicola
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:kva03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1866713..1867324
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIILEKQPPLVLLETAGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVASLVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPAGPTADDAEQEAVAALVALGYKPQEASRM
VSKIARPDANSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcattctcgaaaaacaacccccgctggtgttgctggaa
acggcgggcgtcggctatgaagtgcatatgccaatgacctgcttctatgagctgccggag
gccggtcaggaggcgatagtctttacccactttgtggtgcgtgaagatgcccagctgctg
tatggttttaacaacaaacaggaacgtacgctgtttaaagagctgattaaaaccaacggt
gtggggccaaagctggcgctggcgatcctctccggcatgtcggcgcagcagttcgtcaat
gccgttgagcgggaagaagtcgcctcgctggtgaagctgccggggattggcaaaaaaacc
gcagaacgcctgatcgtcgagatgaaagaccgtttcaaagggctgcacggcgacctgttc
actccggcggccgatctggtgctgacctcgccggcaggcccgacggcagatgatgccgaa
caggaagcggttgccgcgctggtcgcgctgggctataaaccgcaggaggccagccggatg
gtaagcaagattgcccgtccggacgccaacagtgaaacgctaatccgcgaagcgctgcgc
gccgcgttgtga

DBGET integrated database retrieval system