KEGG   Lactobacillus acidophilus NCFM: LBA1065Help
Entry
LBA1065           CDS       T00231                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBA1065
   01230 Biosynthesis of amino acids
    LBA1065
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBA1065
  Energy metabolism
   00680 Methane metabolism
    LBA1065
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBA1065
Enzymes [BR:lac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LBA1065
Exosome [BR:lac04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LBA1065
  Exosomal proteins of melanoma cells
   LBA1065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1046468..1047064
Genome map
AA seq 198 aa AA seqDB search
MRLLVVRHGQSEADILKVCEGRADFSLTKLGHEQVEKTAEYISENYKVDKIYSSTLKRAM
QTAEHVAKKTNLKVNLEDKLQEFNNGLRAGMNYKLAYEKYPNIPAAIHESHYQQESELEF
RMRAEYVLSQITSENDPTSTTVIVSHGGMIMRLFQAFLQLPIGSNVKLITGDAGIHDWSI
ENEQKFINYSNFCPFLSN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcgattattagtagttagacatggtcaaagtgaagccgatatattaaaagtatgtgaa
ggtcgagcagatttttctttgacaaaattagggcatgaacaagtagaaaaaactgcagag
tatatttcagaaaactacaaagtagataagatttattcaagtactttaaaacgagctatg
caaaccgcagaacacgtagcgaagaaaacaaatcttaaagttaatttagaagataaattg
caggaatttaataacggtttaagagcggggatgaattataaattggcttatgaaaaatat
cctaatatacctgctgcaatacatgaatcacattatcagcaagaaagtgaacttgaattt
aggatgagggccgagtatgttctctcacaaatcactagtgaaaatgatcctacttcaaca
actgtaatagttagtcatggtggaatgattatgcgattatttcaagcctttcttcaatta
ccaataggatctaatgttaagttaattaccggagatgctgggattcatgactggtcaatt
gaaaatgaacaaaagtttataaactattctaatttttgtccatttttatcgaattaa

DBGET integrated database retrieval system