KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0101Help
Entry
Lbuc_0101         CDS       T01477                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lbh00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
105492..106997
Genome map
AA seq 501 aa AA seqDB search
MDDKKVRVRYAPSPTGFLHIGNAQSALFNYLFAKHFGGTMVLRIEDTDTKRNVPHGEDSQ
IENLHWLGIDWDEGPDKPNPKYAPYHQTQRVSLYHKYIQQLLDKGFAYKDYTTEDELKVM
RDEQRKNGEAPHYDGRWYGRSEEDQKAAEKQGLKPDVRLHLPSNHIYAWDDIVKGNVQFN
SDNMGGDFIIEKSNGMPTYNFAVVIDDYLMDITHVLRGDDHIANTPKQIAVYEALGITPP
RFGHITLIYNPKTGKKLSKRDKETLQFISQYKNQGYLSEAIFNFIAFLGWSPVGEKELYS
KDELIKAYDPDRMSKSPAFFDQHKLDWMNSQYIKNADVADLTDRIMDLIKEGESEIAKKL
QDVNLPNLREFIKHVTKVYQREVYKLTDIMEKVYFFANVDSETFDYSQFDDFSPVVVRLI
LMQFRRELLDASEKGDIDFDTIIRSVGNATGIKGRELYFPLNVTFTGNTNAPQVGSILKL
YSISTIINLVDKALTGTEVKS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggacgataagaaggttagagtaaggtatgcaccaagtccaacaggattcctgcatata
ggtaatgcacaatcagcattgtttaactatttgtttgcaaaacattttggaggaacgatg
gtattaagaattgaggataccgatacaaagagaaatgttcctcatggtgaagacagtcag
atagaaaacttacactggcttggaattgactgggatgaaggacctgataagcctaatcct
aagtacgcaccttaccaccaaacccaaagagtgtcattgtatcacaagtatatccaacaa
ttgctcgacaaggggtttgcctacaaagattacactactgaagacgaactcaaggttatg
cgtgacgaacaacgaaaaaacggtgaagcccctcattatgacgggcgctggtatggaaga
agcgaagaagatcaaaaggcagctgaaaagcagggattaaagcctgatgtgcgtcttcat
ttgccaagtaatcatatctatgcttgggatgacattgtaaaaggtaacgttcaatttaat
tctgacaatatgggtggggatttcattattgaaaagagtaatggaatgccaacatataac
ttcgcggttgttattgatgattatttgatggatattacacacgtgcttcgtggcgatgat
catattgcgaacactccaaagcaaattgcagtgtatgaggcgcttggtattactccacct
agatttggccatatcactctaatttacaatccaaaaactggcaaaaagttaagtaaacgt
gacaaagaaacgttacagtttattagtcagtataagaatcaaggttacttgagtgaagcg
atttttaactttatcgcattccttggatggtctccagttggtgaaaaagaactttattcc
aaggacgaattaattaaggcttatgatcccgaccggatgtctaaatctcctgcattcttt
gatcaacacaaattagactggatgaactctcaatacatcaaaaatgctgatgttgcagat
ttaacggatcggataatggatctgattaaagaaggcgaatcagagattgctaagaagctc
caggatgttaatttgccaaacttgcgtgaattcatcaagcatgtaactaaggtttatcaa
cgtgaggtttataaacttaccgacattatggaaaaagtatacttctttgcaaatgtggat
agtgagacatttgattactcacaatttgatgatttctcgccggtggttgttcgactaatt
ttgatgcaatttaggagagaattgttagatgccagtgaaaagggtgatatcgactttgac
acgattatccgatcggtgggaaatgcaactggaattaaagggagagaactgtatttccca
ttaaacgtaacctttacagggaatactaatgctccacaggttggtagcattttaaaactg
tattcgatcagtacaattattaatttggttgataaggcgcttacaggaactgaagtaaag
agttaa

DBGET integrated database retrieval system