KEGG   Leptospira borgpetersenii JB197: LBJ_1249Help
Entry
LBJ_1249          CDS       T00404                                 

Definition
(GenBank) Chemotaxis protein, methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj02020  Two-component system
lbj02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LBJ_1249
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    LBJ_1249
Enzymes [BR:lbj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     LBJ_1249
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     LBJ_1249
Two-component system [BR:lbj02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   LBJ_1249
Bacterial motility proteins [BR:lbj02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    LBJ_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest
Motif
Other DBs
NCBI-ProteinID: ABJ75845
UniProt: Q04TC5
Position
1:1482035..1482595
Genome map
AA seq 186 aa AA seqDB search
MKYEAIVIGVSAGGMNAMKTILPSLPAGYGIPLILVQHIGPRSDGTWIRVLRDFSRIKIK
EAEEKEKIEPGTVYVAPPNYHLLIEKDKTVSLSTSERVNFSRPSIDVLFESASDAYGDGL
IGIVLTGANSDGAKGLKKIKENGGLAIVQDPLYSEVSLMPESAIRAGPVDYILSLEKIAE
LLIRLD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgaggcgattgtgataggagtttccgcaggggggatgaatgccatgaaaacg
atattgccgtctttacccgcgggatacggaattccgttgatcctcgttcagcatatcggt
ccccgttccgacgggacgtggattcgggttctccgggatttttctaggatcaaaatcaaa
gaggcggaggaaaaggaaaagatcgaaccgggaacggtttatgtagctccgcctaattat
catttattgattgaaaaagataaaacggtttccctttcaactagcgagcgagtgaatttt
tcgaggccttctatagacgttttatttgaatccgcttcggatgcttatggtgacgggttg
atcggaatcgttttaacgggtgcaaattcggacggtgcaaagggtttaaaaaagataaaa
gaaaacggcggtttggcgatcgttcaagatccattatactccgaggtttctttgatgccg
gagtcggctatcagggcggggccggtggattatatactttctttggaaaagattgcggag
ctactgataagattggattaa

DBGET integrated database retrieval system