KEGG   Lactobacillus brevis ATCC 367: LVIS_0996Help
Entry
LVIS_0996         CDS       T00406                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
lbr00010  Glycolysis / Gluconeogenesis
lbr00052  Galactose metabolism
lbr00500  Starch and sucrose metabolism
lbr00520  Amino sugar and nucleotide sugar metabolism
lbr00521  Streptomycin biosynthesis
lbr01100  Metabolic pathways
lbr01110  Biosynthesis of secondary metabolites
lbr01120  Microbial metabolism in diverse environments
lbr01130  Biosynthesis of antibiotics
lbr01200  Carbon metabolism
Module
lbr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LVIS_0996
   00052 Galactose metabolism
    LVIS_0996
   00500 Starch and sucrose metabolism
    LVIS_0996
   00520 Amino sugar and nucleotide sugar metabolism
    LVIS_0996
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LVIS_0996
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LVIS_0996
Enzymes [BR:lbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LVIS_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: ABJ64129
JGI: LVIS0996
UniProt: Q03RP3
Position
complement(1013656..1014627)
Genome map
AA seq 323 aa AA seqDB search
MARNLIGIDLGGTTTKMAFLSLAGEVLTKWSIPTDIADEGSHIVPNIIDSISQHITNSEF
SKDDFLGIGMGTPGSVDIENGTVIGAFNLNWKKRQQVRDQIQAGLGLQFILDNDANVASL
GEYWKGAGEKDSDVVFVTLGTGVGGGVIAGGHLLHGINGGAGELGHVTVQPNGYLCTCGK
RGCLEQYASATGVVHVAADMAKDFMGTSRLKEMEDNQESVTSKMVFYLADNGDILANQVV
DRVTFYLGLALANVANILNPANIIIGGGVSNAGNTLLQPTTRYFQENAFPAVRDSTKLRL
AQLGNDAGIIGAASLALRFQKTN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcacggaatttaattggaatcgatttaggtgggactaccactaaaatggcctttcta
tcactggctggggaagtcttgaccaagtggagtattccaactgatatcgccgacgagggg
agccacattgttccaaatattatcgactcaatcagtcaacacattacgaactcagaattc
agtaaagacgactttctgggtatcggaatggggacgccgggttcagtagatattgagaat
ggaaccgtcattggggcctttaacttgaactggaagaaacggcaacaggttcgtgatcaa
attcaagcaggtttaggccttcaatttatcctggataatgatgctaacgtggcatcatta
ggcgagtactggaaaggtgctggcgaaaaggatagtgatgtggtctttgtaaccctagga
acgggtgtcggcggtggtgttatcgctggcggccacctcttgcacgggattaacggtggg
gctggtgaattgggccacgtaaccgttcaaccgaatggctatctatgtacttgtggcaaa
cgtggttgtctggaacaatatgcttccgcaaccggagtggttcacgtggctgccgatatg
gctaaggatttcatgggaacttctcgattgaaagaaatggaagacaaccaggaaagcgtg
acgtcaaagatggtcttttatctagccgataatggggacatcttggcaaaccaagtggtt
gaccgggtcaccttttatttagggttggctttagccaacgttgccaacattttaaatcca
gccaacatcattattggtggtggggtttctaacgctgggaacacgttattacaaccaacg
acgcggtatttccaagaaaatgcctttccagcagttcgggattcaaccaaactgcgattg
gcacaactcggaaatgacgcagggattattggcgcggcatcactcgctttacgattccaa
aaaacgaattaa

DBGET integrated database retrieval system