KEGG   Lactobacillus brevis ATCC 367: LVIS_2259Help
Entry
LVIS_2259         CDS       T00406                                 

Definition
Beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LVIS_2259
  Lipid metabolism
   00600 Sphingolipid metabolism
    LVIS_2259
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LVIS_2259
Enzymes [BR:lbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LVIS_2259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2227650..2229536)
Genome map
AA seq 628 aa AA seqDB search
MKADLTWLDDPQTFRINQLPAHSDHRGYASVEEATAQHSSLVQSLDGTWQFAFAPDPVHR
FEGFYQPDYDRSAFDRLTVPGHIELAGYGQIQYINTAYPWEGHHYRRPAYSMGADQPEKG
MFSTDPQNTVGAYVKHFTLNPALANQRVSIEFDGVEQAMFLWLNGQFVGYAEDSFSRSEF
DLTPYLQAGQNLLAVEVFKHSTAAFLEDQDMFRFSGIFRSVRLVAKPELHVEDLTIRAGL
DDAFQTGDLKVRLQLTAASQLSGTATAQLLTADGQEVWATEQPAASTLDLAAAIDHVHLW
DHHDPYLYQLRITLKDVAGQVVEVVPYPVGFRRIELKDKVMCLNGQRLILNGVNRHEWDA
HRGRAVTMADMTQDLQTFHDNHINAVRTCHYPDQDAWYYLCDQQGIYMMAENNLETHGTW
QKMGAVEPSYNVPGSLPQWQLAVLDRAKSNYEMFKNHPAVLFWSLGNESYAGDNIAAMDA
FYHHADPTRLTHYEGVCRNRVYEDRISDMESMMYDPPRAIEDYLKNDPQKPFVNCEYMHD
MGNSLGGMASYDALIDQYPMYQGGFIWDFIDQALWVKDEVTGQPVLRYGGDFDDRHSDYE
FSGDGLLFADRTPKPALQEVDYYYGQHD
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcagatcttacttggttagatgatccgcagacatttcggatcaatcaactacca
gcgcacagtgatcaccgtgggtatgcttcagttgaggaagccaccgcgcagcacagtagc
ctggttcaaagtctcgacgggacctggcaatttgcctttgcgccagacccagtgcatcga
tttgaaggcttctaccaacctgattatgaccgttcagcctttgatcggctgacggtgcca
ggtcatattgagctagctggttatggtcagattcagtatatcaataccgcctatccgtgg
gaggggcatcattatcgacgaccggcttacagtatgggcgctgatcagccagaaaaaggg
atgtttagtacggatccccaaaatacagttggggcttacgtcaagcactttaccttgaac
ccagcgctagccaatcaacgggttagcattgaatttgacggtgtcgaacaggccatgttt
ctctggctcaacggccagtttgtgggctacgccgaagatagctttagccgttcagaattt
gatctgacgccttatttacaggccgggcaaaatttattggccgtggaagtctttaaacat
agtacggccgcttttttggaagaccaagatatgttccggttttcgggtatcttccggagt
gttcggttggttgccaagccggagctgcatgtagaagatttaaccattcgagctggttta
gatgacgcgtttcagacaggtgatttaaaagtgcgcttgcaactgacggctgctagccaa
ctttcggggactgcgacggcgcaactactaacggccgatggtcaagaagtctgggcaact
gagcaaccggcggctagtacgttagacttggcggccgcgattgatcacgtccacctgtgg
gatcaccacgatccttacctttaccaattgcggattactttaaaagatgttgccggtcaa
gtggtggaagtcgtcccttatccagtgggcttccggcgcattgaactcaaagataaagtc
atgtgcttaaacggtcagcggttaattttaaatggtgtcaatcgccacgaatgggatgcg
catcgtggccgggccgtgactatggcggacatgacacaggatctccaaacttttcacgac
aaccatatcaatgcggtgcggacgtgccactatccggaccaagatgcctggtattactta
tgtgatcagcaaggtatttacatgatggctgaaaataacttggagacgcacggaacttgg
caaaaaatgggggctgtggagccgtcttacaatgtgccaggaagcttgccacaatggcag
ttagccgtgcttgatcgggccaagagtaactatgagatgtttaagaatcatccagccgtt
ttattctggtcactggggaacgaatcctatgctggcgataacatcgcggcaatggatgcc
ttctaccaccacgccgatccgacgcgcttaactcattatgaaggggtgtgccgtaatcgg
gtctatgaagatcgcatctcggatatggaaagtatgatgtatgatccgccacgtgcgatc
gaagattaccttaaaaacgatccccagaaaccctttgtcaattgcgagtacatgcatgac
atgggcaactcactgggcgggatggccagttatgatgcgttgattgaccaatacccaatg
tatcagggtgggtttatttgggacttcattgaccaggccttgtgggttaaagatgaggtt
acgggacagccagtactgcggtatggcggtgactttgacgatcgccattctgattatgaa
ttttccggtgacgggctgttatttgctgaccggacacccaagccagctttacaggaggtg
gactattactatggacaacacgactaa

DBGET integrated database retrieval system