KEGG   Lactobacillus paracasei ATCC 334: LSEI_1307Help
Entry
LSEI_1307         CDS       T00407                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lca  Lactobacillus paracasei ATCC 334
Pathway
lca00010  Glycolysis / Gluconeogenesis
lca00020  Citrate cycle (TCA cycle)
lca00620  Pyruvate metabolism
lca01100  Metabolic pathways
lca01110  Biosynthesis of secondary metabolites
lca01120  Microbial metabolism in diverse environments
lca01130  Biosynthesis of antibiotics
lca01200  Carbon metabolism
Module
lca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSEI_1307
   00020 Citrate cycle (TCA cycle)
    LSEI_1307
   00620 Pyruvate metabolism
    LSEI_1307
Enzymes [BR:lca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LSEI_1307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 RnfC_N DUF2118 DUF1780
Motif
Other DBs
NCBI-GeneID: 4419668
NCBI-ProteinID: YP_806530
UniProt: Q039N4
Position
1289329..1290984
Genome map
AA seq 551 aa AA seqDB search
MAFEFKLPELGEGLAEGEIVKWDVKPGDDIKEDDTLLEVQSDKSVEEIPSPVSGKILKIL
VPEGETASVGDLLVEIDDGSGPAAAPATATAAPATPAPATPAVQPAPAQSVYQFKLPELG
EGLAEGEIVKWTVKPGDQIKEDDTLLEVQSDKSVEEIPSPVAGTVVKILVPEGETATVGE
ALVDIDAPGHNDTSVATEAGAAPQPVAATPAATPAAPAAGGVTAITDPNREILAMPSVRQ
YAREQGIDISQVPATGKHGRITKADVDAFKTGAPAASAQPAAPAAQAQPQPATAKPAAPA
APKPQAVAPYVSSGNEAELETREKMTPTRKAIAKAMLASKQRSPHVTSFDDVEVSKLMAH
RKKYKQYAADKGIKLTFLPYIVKALVTVLREYPEFNASIDDTTDEIVYKHYFNIGIATNT
DHGLYVPVIKNADAKSMFEIAKEISENAQKAYDSKLKPDEMRGGSMTISNVGSIGGGWFT
PVINQPEVAILGVGKIAKEPYVNEDNEIVVGNMLKLSLSYDHRLIDGALAQTALNLMDKL
LADPDLLLMEG
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattcaaactgccagaacttggcgaaggtttggcagaaggcgaaatcgtt
aagtgggacgtcaaacctggtgatgacatcaaggaagacgataccttacttgaggttcaa
agtgataaaagtgttgaagagattccatctccggtctccggcaaaattttaaaaattctt
gttccagaaggggaaaccgcgtcagttggtgatctattggttgaaatcgatgatggctcc
ggaccggcagctgcacctgcgactgcaacagcagcccctgcgacacccgctccagcaacg
cctgctgtgcaacctgcacctgcgcaatcggtttatcagtttaagttacccgaactaggc
gaaggtttggcagaaggcgaaattgttaaatggacagtcaagcctggcgatcaaatcaaa
gaggacgacacgctgttagaagttcaaagcgacaagagtgtcgaagaaattccttctcca
gttgccggaacggttgttaagattctggtaccagaaggcgaaaccgcgacagtcggtgaa
gcgctggttgatattgatgcaccgggtcataatgacacatcggttgctactgaggctggc
gctgcaccgcagccggttgctgcaacaccggctgcgacgccagctgcaccagcagcgggt
ggcgtgacggccatcaccgatccgaaccgggaaattttagcaatgccatctgtgcgtcag
tatgcacgcgaacagggcattgacatctcacaagtgccagcaaccggcaaacatggccga
attaccaaggctgatgtcgatgcattcaagacgggcgcaccagctgcatctgcacagcca
gcagcccctgctgctcaggcacaaccgcaaccagccacagcaaagccagctgcaccggca
gcaccaaagccgcaagcagttgcaccatacgtttcgagtggtaatgaagctgaacttgaa
acccgtgaaaagatgaccccaactcggaaagcgattgctaaggcgatgcttgcttctaag
caacgtagcccgcatgtgacgagttttgatgacgttgaagtttctaagttaatggctcat
cgcaagaagtacaagcaatacgcagctgataagggtatcaagttaaccttcctgccgtat
atcgtcaaagcacttgtgacggtgttgcgtgaatatccagaattcaatgcgtccattgat
gatacaacggatgaaattgtctataagcattacttcaacattgggattgcaacaaatacg
gatcacggcttgtatgtgcctgtgatcaagaatgccgatgcaaagagtatgtttgaaatt
gctaaggaaattagtgaaaatgcccagaaggcttatgacagcaaactaaagccggatgaa
atgcgcggtggctccatgaccatcagtaacgttgggtcaattggcggcggctggttcacc
ccagtgatcaatcaacctgaagttgcgattctcggagtgggcaaaattgctaaggagcct
tatgtcaacgaagacaacgaaattgtggttggcaacatgttgaaattaagtttgagctat
gaccatcgtttgattgacggcgcgttagcacaaaccgccttgaatctgatggataaattg
ttggcagatcctgatctgctgttgatggagggataa

DBGET integrated database retrieval system