KEGG   Leptothrix cholodnii: Lcho_0267Help
Entry
Lcho_0267         CDS       T00681                                 

Definition
putative thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
lch  Leptothrix cholodnii
Brite
Enzymes [BR:lch01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Lcho_0267
Secretion system [BR:lch02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Lcho_0267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(282692..283399)
Genome map
AA seq 235 aa AA seqDB search
MLLRLIAIACSLWAGAALADEADIRKTLTERFQGLPKIDEIRPTPIPGVFEVRIGTDLMY
SDAKGTYLLQGSLIETATRRNLTEERVDKLTAIDFNSLPLKDAVVWKNGKGTRKIAVFAD
PNCGYCKKLERDLLNVKDVTVYTFVIPILGGDSPEKSKSIWCAKDSTATWRNWMVDGTLP
PKAMGNCDASAIERNSALARKHRVTGTPAIVFEDGSRAPGAIPAAEIERRMAAKS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgcgcctgatcgccatcgcctgctccctctgggccggtgcggccctggccgac
gaggccgacatccgcaagacgctgaccgagcgtttccagggcctgcccaagatcgacgag
atccgcccgacgccgatccccggcgtgttcgaggtccgcatcggcaccgacctgatgtac
agcgacgccaagggcacctacctgctgcagggctcgctgatcgagaccgccacacgccgc
aacctgaccgaggagcgggtcgacaagctcaccgcgatcgacttcaacagcctgccgctc
aaggacgcggtggtctggaagaacggcaagggcacacgcaagatcgcggtcttcgccgac
cccaactgcggctattgcaagaagctcgagcgcgacctgctcaacgtcaaggacgtcacc
gtctacaccttcgtgatcccgatcctgggtggcgattcgcccgagaaatcgaaatcgatc
tggtgcgccaaggacagcaccgccacctggcgcaactggatggtcgacggcaccctgccg
cccaaggcgatgggcaactgcgacgcctcggcgatcgagcgcaacagcgcgctggcgcgc
aagcaccgcgtcaccggcacgccggcgatcgtgttcgaggacggcagccgcgccccgggc
gcgatccccgcagccgagatcgaacggcgcatggccgccaagtcctga

DBGET integrated database retrieval system