KEGG   Leptothrix cholodnii: Lcho_0461Help
Entry
Lcho_0461         CDS       T00681                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lch  Leptothrix cholodnii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lch00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lch00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
500997..501572
Genome map
AA seq 191 aa AA seqDB search
MDNPFRRRALLGLAAWPLVLASGQASGASTACPALLDRSIPRLQDEQAQALCQYSGKVLL
IVNTASACGYTSQYEGLQKLHEQYRERGLVVMGFPSNDFAGQESGDNRQIAEFCENQFAV
RFPMFVKGAVRGPQAQPLYADLKRLSGQAPGWNFHKYLVGRDGRSVRSYASAVGPDDRRL
RLDIETFLNAR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccccttccgtcgtcgagcccttctgggccttgcggcctggccgctggtgctg
gcatcgggccaggcgtcgggtgcgtcgacggcctgtccggcgctgcttgaccgatcgatc
ccccggcttcaggacgagcaggcgcaagcactctgccagtacagcggcaaggtgctgttg
atcgtgaacaccgccagcgcctgcggctacacctcgcaatacgaggggctgcagaagctg
catgaacagtaccgcgagcgcggcctggtggtgatgggttttccgtccaacgacttcgcc
ggccaggagtcgggcgacaaccggcagatcgccgagttctgcgagaaccagttcgccgtg
cgcttcccgatgttcgtcaagggcgccgtgcggggcccgcaggcgcagccgctgtatgcc
gacctgaagcggctgagcggccaggcgccgggctggaatttccacaagtacctggtcggc
cgcgacggccggtcggtgcgcagttacgccagtgccgtcggcccggacgatcgtcgtctc
aggctggacatcgaaaccttcttgaatgcccgttga

DBGET integrated database retrieval system