KEGG   Leptothrix cholodnii: Lcho_0461Help
Entry
Lcho_0461         CDS       T00681                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lch  Leptothrix cholodnii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Lcho_0461
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Lcho_0461
Enzymes [BR:lch01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Lcho_0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
500997..501572
Genome map
AA seq 191 aa AA seqDB search
MDNPFRRRALLGLAAWPLVLASGQASGASTACPALLDRSIPRLQDEQAQALCQYSGKVLL
IVNTASACGYTSQYEGLQKLHEQYRERGLVVMGFPSNDFAGQESGDNRQIAEFCENQFAV
RFPMFVKGAVRGPQAQPLYADLKRLSGQAPGWNFHKYLVGRDGRSVRSYASAVGPDDRRL
RLDIETFLNAR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccccttccgtcgtcgagcccttctgggccttgcggcctggccgctggtgctg
gcatcgggccaggcgtcgggtgcgtcgacggcctgtccggcgctgcttgaccgatcgatc
ccccggcttcaggacgagcaggcgcaagcactctgccagtacagcggcaaggtgctgttg
atcgtgaacaccgccagcgcctgcggctacacctcgcaatacgaggggctgcagaagctg
catgaacagtaccgcgagcgcggcctggtggtgatgggttttccgtccaacgacttcgcc
ggccaggagtcgggcgacaaccggcagatcgccgagttctgcgagaaccagttcgccgtg
cgcttcccgatgttcgtcaagggcgccgtgcggggcccgcaggcgcagccgctgtatgcc
gacctgaagcggctgagcggccaggcgccgggctggaatttccacaagtacctggtcggc
cgcgacggccggtcggtgcgcagttacgccagtgccgtcggcccggacgatcgtcgtctc
aggctggacatcgaaaccttcttgaatgcccgttga

DBGET integrated database retrieval system