KEGG   Leuconostoc citreum: LCK_00356Help
Entry
LCK_00356         CDS       T00663                                 

Gene name
sucP
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lci  Leuconostoc citreum
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LCK_00356 (sucP)
Enzymes [BR:lci01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LCK_00356 (sucP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
364964..366421
Genome map
AA seq 485 aa AA seqDB search
MEIQNKAMLITYADSLGSNIKEVHQVLKEDIGDAIGGVHLLPFFPSTGDRGFAPSDYTRV
DATFGDWNDVEALGQEYYLMFDFMINHISRESEMYQDFKANHDQSKYRDFFIRWEKFWQQ
AGPDRPTQEDVDLIYKRKDKAPIQEITFADGTTEHLWNTFGEEQIDIDVNSQIAKAFIKA
TLEDMVQHGANLIRLDAFAYAVKKVGTNDFFVEPEIWAVLNEVRDILAPMHAEILPEIHE
HYTIPQKINAHGYFTYDFALPMTVLYTLYSGKTNRLANWLKQSPMKQFTTLDTHDGIGVV
DARDILTDEEIDYASEELYKVGANVKKTYSSAAYNNLDIYQINSTYYSALGNDDAAYLLS
RVFQVFAPGIPQIYYVGLLAGENDIDLLESSKEGRNINRHYYTREEIKSAVKRPVVADLL
ALLSWRNQFSAFALDGTITVETPSEHDIKITRTDHSGDNIAILLANAKTRTFVITANGKT
VLQNK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcaaaacaaagcaatgctcattacgtatgctgattctttgggcagtaatatc
aaggaagtccaccaagttttgaaagaagacattggcgatgcgattggcggggtacatttg
ttaccatttttcccttctacaggtgatcgtggcttcgccccttctgattacacgcgtgtt
gatgcaacatttggtgattggaatgatgttgaggcacttgggcaagaatactatttgatg
tttgattttatgatcaaccatatttctcgtgaatcggagatgtatcaagattttaaagca
aatcacgatcaatcaaagtaccgtgatttcttcattcgctgggaaaagttttggcaacag
gctgggccagatcgaccaactcaagaagacgtcgaccttatttataagcgcaaagacaag
gcgccaattcaagaaatcacttttgctgatggcacgacagagcatctttggaatacattt
ggtgaagaacaaattgatattgatgttaattctcaaattgctaaagccttcattaaagca
acgctagaagacatggtccaacatggtgccaatttgattcgtttagatgctttcgcctat
gctgttaagaaagttgggacaaatgatttctttgtcgaaccagaaatatgggctgtttta
aacgaagtgcgtgacattttggcacctatgcatgctgaaattttaccagaaattcatgag
cattatacaattcctcaaaagatcaacgcccatggttatttcacttatgattttgctttg
ccaatgacagtactttatacgctttactcaggcaaaacaaatcgactagccaactggctc
aaacagtctccgatgaaacaattcacgacgttagatacgcatgatggcattggggttgtt
gacgcacgtgatattttgacggacgaagaaattgattatgcttctgaggaattatacaaa
gttggtgccaatgtcaaaaagacctactcatcagctgcgtataataacttagatatttat
cagattaattcaacttactattcagctttaggcaatgatgatgccgcatatttgttgagt
cgtgttttccaagtttttgcacctggtattccacaaatttattatgtcgggttacttgca
ggcgagaatgatattgatttgttggaatcttcaaaagaaggtcgtaatattaatcgtcat
tactatactcgtgaagaaataaaatcagctgttaagcggccagttgttgctgacttattg
gcattattatcatggcgtaatcagttttcagcatttgctctggatgggacaatcactgtc
gagacaccatcagaacatgatattaaaattacacgaacggatcattccggagataatata
gctattttgctagctaatgccaagacacgcacctttgtcatcacagcaaatggcaagaca
gtcttacaaaacaaataa

DBGET integrated database retrieval system