KEGG   Latimeria chalumnae (coelacanth): 102365585Help
Entry
102365585         CDS       T02913                                 

Gene name
UCHL1
Definition
(RefSeq) ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
  KO
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102365585 (UCHL1)
Peptidases [BR:lcm01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102365585 (UCHL1)
Ubiquitin system [BR:lcm04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    102365585 (UCHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 224 aa AA seqDB search
MQWQPMEINPEMLNKVLARLGVSGSWHLVDVLGLEEESLASVPTPVCALMLLFPLTAQHE
SFRKKQMEEVAEKQVNPKVYFMKQTIVNSCGTVGLVHAVANNQDKLKFEDDSALKQFLTE
TADMSAGDRAKCLEKNKIIQEAHDAIAKEGLCRVEEGSVNFHFITFANIDGNLYELDGRM
SFPVNHGSTTKDTLLQDAAKICRQFTEREQGEVRFSAVALCKVK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggcaaccaatggaaattaaccctgagatgctgaataaagtgctggcccggctg
ggtgtgtctggaagctggcatcttgtagatgtcttggggctggaagaagaatctttggcc
tctgtcccaaccccagtctgcgctctcatgctgctctttcctctcaccgcacagcatgaa
tcttttagaaaaaagcaaatggaagaggttgcagaaaaacaagtcaatcccaaggtctac
ttcatgaagcaaacaattgtgaattcttgtgggactgttggccttgtccatgcagttgct
aacaaccaggataaacttaaatttgaggatgattcagcactcaagcagttcttgactgaa
actgctgacatgtctgcaggagaccgagccaaatgtcttgaaaagaacaagattattcaa
gaagcccatgatgccattgcaaaagaagggctgtgtcgggtagaagaaggcagtgtgaac
tttcatttcataacctttgccaatatagatggaaacctctatgaactagatggaagaatg
tcctttcctgtgaatcacggcagtacaaccaaggacacactcttacaggatgctgccaaa
atctgtaggcagttcacagaacgtgaacaaggagaggttcgcttctcagctgtggctctt
tgcaaggtgaaatga

DBGET integrated database retrieval system