KEGG   Lactobacillus casei BD-II: LCBD_0739Help
Entry
LCBD_0739         CDS       T01955                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lcs  Lactobacillus casei BD-II
Pathway
lcs00010  Glycolysis / Gluconeogenesis
lcs00052  Galactose metabolism
lcs01100  Metabolic pathways
lcs01110  Biosynthesis of secondary metabolites
lcs01120  Microbial metabolism in diverse environments
lcs01130  Biosynthesis of antibiotics
Module
lcs_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lcs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCBD_0739
   00052 Galactose metabolism
    LCBD_0739
Enzymes [BR:lcs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LCBD_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEA56237
UniProt: A0A125U5P6
Position
725802..726812
Genome map
AA seq 336 aa AA seqDB search
MDVSVEPYGQYQGHNLYELTLTNDQGMVVKLLNYGATLEKVLLPEADGLHNMILSLPSRE
DYAKERNFLGGTVGRVVGRIRGHVWQHGDVKIDLPMNEGKNHIHGGDDGLDRQVYNFRID
QTATTASASFTFVDPAGHNGYPGNVKLQVTYTLENTNTLHYRLDAVSDEETLFNPTNHTY
FAIDQPNKIDATTLTIPADDYKPLDADHLPDQGWQPVAGTVFDFRQGQKLGDVIHTRAAQ
ITAERGINHPFLLKHGQTLAAKLQTDKHTMTLATTAPSVVVYTANHFDGTGIPHNIDQFD
GVALECQFAPVSGDDLSAITLLPGEPFTLVNSWAFE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggacgtttcagttgaaccatacggtcagtatcaaggccacaatttgtatgagctgacc
ttgaccaatgatcaaggcatggttgtgaagttgttgaattatggtgcaaccttggaaaaa
gtgttgttaccagaagctgatggcttgcacaacatgattctgtcgctgccaagtcgggaa
gattacgcaaaagagcgcaattttctcggcggtacggtcggtcgagtggtcggccggatt
cgtggtcatgtttggcagcatggggatgtgaaaattgatctgccaatgaacgaaggtaag
aatcacattcacggcggggatgacggtctggatcggcaagtttataacttccgtattgac
cagacagctaccacagctagtgctagttttacctttgttgatccagcagggcataatggc
tatccgggcaacgtcaagctgcaagtgacttataccttggagaatacgaataccttgcac
tatcgtctggatgcagttagtgatgaagaaacgctcttcaatccaactaaccatacctat
tttgcgattgaccagccaaacaaaattgatgccaccacgctgacgattccagccgacgat
tacaaaccgcttgatgcagaccatctgccagatcaaggctggcagccagttgctggaacg
gtctttgattttcggcaagggcaaaagcttggcgatgtcattcacactcgagcagcgcaa
atcactgcagaacggggcattaatcacccattcctactgaaacacggtcaaaccctcgcg
gccaaactccagactgacaaacatactatgaccctggcaaccactgcgccgtccgtcgtc
gtatacaccgccaaccactttgatggtaccggtattcctcacaacattgatcaatttgat
ggcgtggctcttgaatgccaatttgctccggtcagcggcgatgatctttcggcgatcaca
ttattgccgggcgaaccatttacgttggtgaatagttgggcgtttgaatag

DBGET integrated database retrieval system