KEGG   Lactobacillus casei BD-II: LCBD_2357Help
Entry
LCBD_2357         CDS       T01955                                 

Gene name
arb
Definition
Glycosyl hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lcs  Lactobacillus casei BD-II
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lcs00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2307503..2308951)
Genome map
AA seq 482 aa AA seqDB search
MTYLNFPKNFLWGGATAANQLEGAYQEDGKGLSIADVLPQGKDRFTIVNRPDFNWTIDKS
KYRYPNHQGIDHYHRFKEDIKLFSEMGFKCYRFSIAWSRIFPEGDEKTPNASGLKFYDEV
IATCLKYDIEPVVTISHYEMPLHLVTKYGGWKNKRLIEFYKHFAETVLTRYFKQVKYWMT
FNEINSAWAFPVMSQGLVANNGGNDKQTIFQAWHNQFVASAWAVKIGHALDPKLQVGCML
LYATTYGYDANPVNQLATLQQNQAFNFFCGDVQVRGEYPAYTDALMADNGFKFTDLDFSA
EELTLLKNHPVDYIGFSYYMSAVVETVEKEHAEVGGNLLSGIKNPFLKASEWGWQIDPIG
LRIALNQLYERYRKPLFIVENGLGAVDKPDADGKIKDDYRIDYLKQHIEQMGAAIHDGLD
LMGYTPWGCIDLVSASSGQMSKRYGFIYVDLDDAGQGSLNRYKKQSFNWYQRVIASNGTD
LG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgacatacctaaattttccaaagaattttttatggggcggtgctacggcagccaatcaa
cttgaaggggcttatcaagaagatggcaagggtctttcaatcgccgatgtgctaccacaa
ggcaaggatcgttttacgattgtgaatcggccagatttcaactggaccatcgacaaaagc
aagtatcgctacccaaaccatcaaggcattgatcattatcatcggtttaaagaagacatc
aaacttttcagcgagatgggatttaaatgctatcgtttttcgattgcgtggtcacggatt
ttcccagaaggtgatgagaaaacaccaaatgcctcgggcttgaaattttatgatgaggtt
attgcgacatgcttgaaatacgatatcgaaccagttgtcacgatttcacattacgagatg
ccgttgcatctggtaaccaaatatggcggctggaaaaataaacgtcttatcgagttttat
aagcattttgcggaaacagttttgactcgctactttaagcaagtaaagtattggatgacg
tttaacgaaattaacagtgcatgggcatttccggtgatgagccaaggattagttgccaat
aatggcggcaatgacaagcaaacaatttttcaagcatggcacaatcagtttgttgccagt
gcttgggccgtgaaaatcgggcatgcgcttgatcctaagcttcaagttggctgcatgttg
ctttatgccaccacttacggctatgatgccaacccagtgaatcaattggcgaccttgcag
caaaatcaggcatttaatttcttttgcggcgatgtgcaggttcgcggcgagtacccagcc
tataccgacgcgttgatggcggacaacgggtttaaattcacagatcttgatttttcagcg
gaggaattaacactgttgaaaaatcatccggttgactacattggttttagctactatatg
tccgccgtagtcgaaacagttgaaaaagaacatgctgaagtcgggggcaacctgcttagt
ggcatcaaaaatccgtttttgaaggcgagtgagtggggctggcagattgatccgattggc
ctgcgcatcgcgttaaatcaattatatgaacgttaccgtaaaccacttttcattgttgaa
aatggacttggcgccgttgacaaaccggatgctgatggcaaaatcaaggatgattatcgg
attgattacttgaagcagcatattgaacaaatgggtgcggccattcatgatggcctggat
ctgatgggctatacgccatggggctgcattgatctggtcagtgcttcttcaggccaaatg
tcgaaacgttacggcttcatctatgtcgatctggacgatgctgggcaaggcagtttaaac
cgttacaaaaagcaatcgtttaactggtatcagcgggtgattgcttccaatggaacggat
ttaggttaa

DBGET integrated database retrieval system