KEGG   Leishmania donovani: LDBPK_360860Help
Entry
LDBPK_360860      CDS       T02289                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ldo  Leishmania donovani
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    LDBPK_360860
  Replication and repair
   03420 Nucleotide excision repair
    LDBPK_360860
Transcription machinery [BR:ldo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     LDBPK_360860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:291336..293009
Genome map
AA seq 557 aa AA seqDB search
MPSSSSALDVPLVEVICSYPTREGLCAECPALLLLVYQHVVAELQAGRRAVDVFRGTSRQ
DHLSELLGVRSLSELFEHLYPLSQSCTLDESTAGSQFWRQARATLEAAWAPPHDAKARAL
LTQVRGQPRFRFCGPRDAETPGEGYPLHPVSLERALATSKRFLRTAMTCALDGSTDALAG
RQPELRAVLQLAHLVPDTPSTGAPPRKEVTPEGISFCMVSLQQRWWVLVNAALERVLLLT
RAAANGNGNTSGSSGVTKPLLWQLLAVLSVLDTAHYVFAFPERQQDLAAHHLLARLSEVG
LVYPLLSNDRKCFVLSPDFLHAIHWHASTPLSLTFNHHLLRSVSGVSDIRREDTDTIITE
TNFRLYAYTDDADLLNILNQFAKLEEIVNGNLHCYRVTRDSFASAMRKGITAAQVLRFLS
LRAHPSMLRRHGEREENGDTTSPSSAGGASSSFTFSASPRRRAVAGTCGSTTSIDAVSTL
VVPQSFCDQMHMWESECRRVVFEHHVVLLRNMSTEQQKAVTAYLIDAGEVDAVAHAERGY
MVIREEVFERLVAPLLR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgagctcctcggcattggacgtgccgcttgtagaagtcatctgcagctatccg
acccgcgaggggctatgcgccgagtgccctgcactgctgctgctcgtctaccagcacgtt
gtagcggagctgcaggcggggcgacgcgccgtggatgtgttccgtggcacctcgcggcag
gaccacctgagcgaattactcggcgtgcgctccttgtcggagctgtttgagcatctctac
ccgctgtcgcagtcttgcaccctcgatgagagcactgcgggctcgcagttctggaggcag
gcacgggctaccttggaggccgcgtgggcgccgccgcacgacgcaaaggcgcgtgccctt
ctcacgcaggtgcgcggccagccgcgattccgcttttgcgggccgcgcgacgccgagacg
cccggggagggctatccactgcaccctgtatcgttggagcgggccttggcaacaagcaag
cgcttcctccgcactgcgatgacctgcgcactggacgggtcaacggatgccctggccggg
cggcaaccggagctgcgcgcggtgctgcagctggcccaccttgttcccgatactccgtcg
acgggagcgcctccgagaaaagaagtcacgccggaggggattagcttctgcatggtgtcg
ctgcagcagcggtggtgggtactggtgaacgcggcgctggagcgcgttctgctgctcact
cgcgctgccgcgaatgggaacggtaacaccagcggcagcagcggcgtcacaaaaccgctt
ctctggcagctgctggcggtgctgtctgtcctagacactgcgcactacgtcttcgccttc
ccagaaaggcagcaggatctcgcggctcaccatcttctcgcacggctgtccgaggtcggg
ctggtgtaccccttactcagcaacgaccgcaagtgctttgtcttgagtcctgacttcctg
cacgccattcactggcacgcgagcacgccgctgtccctcaccttcaatcatcacctcctg
cgaagcgttagcggcgtcagcgacatacgtcgcgaggacaccgacaccatcatcaccgaa
acgaacttccgtctgtacgcgtacaccgacgatgctgacctgctcaacattttgaaccag
ttcgcgaagctggaggagatcgtgaacgggaatctccactgctaccgcgtgacgcgggac
agctttgcctccgcgatgcgcaagggcatcaccgctgcacaagtcctacgctttctttcg
ctgcgagcgcaccccagcatgcttcgccggcacggggagcgggaggagaacggtgacacg
acgtcgccatcgtctgctggcggcgcctcctcttccttcactttttcagcgtcccctcgt
cgtagggctgttgcgggcacgtgtgggagcaccacctccattgatgcggtgtcgacgctt
gtggttccgcagtccttctgcgaccaaatgcacatgtgggagagcgagtgtcgccgcgta
gtgtttgagcaccacgttgtcctgctacgcaacatgtcaacggagcaacagaaggcggtg
acagcgtatttgatcgatgcaggggaggtcgatgccgttgcgcacgctgagcgcggctac
atggtgattcgtgaggaagtcttcgagcgtcttgtcgcaccacttttaaggtga

DBGET integrated database retrieval system