KEGG   Lactococcus garvieae Lg2: LCGL_1864Help
Entry
LCGL_1864         CDS       T01963                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lgv  Lactococcus garvieae Lg2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lgv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LCGL_1864
Enzymes [BR:lgv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     LCGL_1864
Exosome [BR:lgv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LCGL_1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1843736..1845703)
Genome map
AA seq 655 aa AA seqDB search
MMKRRFLRMLNILQYDPYLEPYKADLSYRLFEFSRTKKRLLGMEGKLTDFANGHKYFGFQ
QEKEYWTFREWAPHAEKAFLVGDFNDWTDKHELKAAYGGIWEIAVPGALPLGSKVKVKLI
INGAEVYRVPSYALYAVQNEYLELDGVIVAPDYQFQHSSPLLEEEAPLIYEAHIGISSEE
HKINTYQEFTQDILPRIKAAGYNTIQLMAIMEHPLYASFGYQVSNFFAISSRFGRPEDLM
ALIDTAHGMGLRVLLDVVHSHAVKNVGDGLNLFDGSSDQYFHQGARGEHAAWNTKLFNYG
KDEVIHFLLSNLKFWLETYHFDGFRFDGVTSMLYHHHGLGTSFDSYKKYFSTDTDIEAVV
YLMLATELVHQVNPQATLIAEDMSAMPGMALPISEGGIGFDYRLSMGVPDYWIKQFKEKS
DEELDLMQLWWELTTRRPGEKNIGYVESHDQALVGDKTLMMWLANEAIYDAMDIHSTSMV
VDRAIALHKIVRLITFSLAGEGYLNFMGNEFGHPEWLDFPREGNQDSFQHARRQWSLAAK
ENLRYHYLLKFDHDMIALEKNYHFLKQSDSLQQYWIKNEDKLLAYRKGSLLFVLNFHPTM
EKKLQLDVDNPPTFILDTDDQKYGGFGPRSSFSHQKETGKLELSLAARTAMVFQL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaagaggaggtttctcagaatgttaaatattttgcagtatgatccgtacctagaa
ccctataaggcggacttgtcctaccgcttatttgaattttcaagaacgaagaagagatta
cttggaatggaggggaagcttacagattttgccaatggtcataaatattttggctttcaa
caagaaaaagagtattggactttccgtgaatgggcccctcatgctgaaaaagctttttta
gtgggggactttaatgattggacagacaaacatgaactgaaggcagcttatggtggcata
tgggaaatagctgtaccaggagctttaccacttggttccaaggttaaggttaaacttatt
atcaacggagctgaagtttatagagtgccgtcttatgcgctctatgctgttcaaaatgaa
tacctcgagctggatggtgtgattgttgccccagactatcaatttcagcattcgtcccct
ctcctagaagaggaagcaccacttatttatgaagctcatattggaatttctagcgaagag
cataaaataaatacctatcaagaatttacgcaagatattttgccgcgaatcaaggcggcg
ggatacaatacgatacagcttatggccattatggagcaccccttatatgcaagttttggt
tatcaagtttcgaacttttttgcaatatcaagccgtttcggaagacctgaggatttgatg
gctttaattgatacagcacatgggatgggacttcgtgttttgttggatgtggtccattca
catgctgtaaaaaatgtcggagatggtctgaatctttttgatggaagtagtgatcagtac
ttccatcaaggtgcgcgtggtgagcatgcagcttggaatacaaaattgtttaactatggg
aaagatgaagttattcactttcttttatctaacctcaagttttggttagagacttatcat
tttgatggtttccgctttgatggggttacgagtatgttgtatcatcatcatgggttaggt
acaagttttgatagttataagaagtatttttcaacagatacagacatcgaagcagttgtt
tatcttatgttggcgactgaacttgtccatcaagtgaacccacaggcaacattaattgcc
gaagacatgtcggctatgccaggaatggcgcttcctatctctgagggagggattgggttt
gactatcgtctttcgatgggggtgccggattattggattaagcaatttaaagaaaaatct
gatgaagagctcgatttaatgcaactttggtgggaattaaccacgcgccgtcccggggaa
aagaatattgggtatgtggaaagtcatgatcaggctttggtcggcgataagacgctcatg
atgtggctggcaaatgaagcaatctatgatgcgatggatatccatagcacatcaatggtg
gttgaccgagccattgccttgcacaaaatagtacgcttgattacatttagtttagctgga
gaaggctacctcaactttatgggaaatgaatttggtcatccagaatggttggactttcca
agagaaggcaaccaagacagttttcaacacgctcgtcgtcaatggtctctcgcagcaaag
gagaacttgcggtaccactacctgctcaagttcgatcatgatatgattgctttagaaaaa
aactatcactttttgaaacaaagtgatagcttgcaacaatactggataaaaaatgaggac
aagcttttagcttatcgtaagggtagcttactgttcgttcttaattttcatcccaccatg
gagaagaaactacagcttgatgtagacaatcctccgacatttatcctcgatacagatgat
caaaaatatggaggatttggtcctcgatcaagtttttctcatcaaaaagaaacggggaaa
cttgaactttcattagctgcccgcacagcaatggtctttcaattgtaa

DBGET integrated database retrieval system