KEGG   Lactobacillus helveticus DPC 4571: lhv_1049Help
Entry
lhv_1049          CDS       T00625                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lhv_1049
   01230 Biosynthesis of amino acids
    lhv_1049
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lhv_1049
   00030 Pentose phosphate pathway
    lhv_1049
   00051 Fructose and mannose metabolism
    lhv_1049
   00052 Galactose metabolism
    lhv_1049
  Energy metabolism
   00680 Methane metabolism
    lhv_1049
Enzymes [BR:lhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     lhv_1049
Protein phosphatases and associated proteins [BR:lhe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     lhv_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1028041..1029003
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVTKTAIHHGLEVFGIRYGFAGLVAGDFVPLTTENVDHK
ISEGGTFLYSARFPEFAQEEVQQKGVEQLKKHGIDAVIVIGGDGSYHGALALTRHGVNSV
GLPGTIDNDIPYTDYTIGFDSACRTAMDAIDKIRDTASSHHRVFVVNVMGRECGDIAMRV
GVASGADAIVIPERPYDVKEIAETITRGFADGKDHGIIVLAEGVMTADKFKDELLKYGDF
DARANVLAHMQRGGSPTVTDRVNATKMGNYAVKLLLDGKGGLAVGMENGQLSTHDILDLF
DGKHHGDYALLDVNEEMTKY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtattttaactagtggcggagacgcccctggtatgaatgcagcaatt
agagctgtcaccaagactgctatccatcatggacttgaagtctttggaattcgttatggt
ttcgctggtttggttgcaggtgactttgttccgcttactacggaaaatgttgaccacaag
ataagtgaaggcggtacatttttgtacagtgcccgcttccctgaatttgcacaagaagaa
gtgcaacaaaagggtgttgagcaattgaagaaacatggtattgatgctgttatcgttatt
ggcggtgacggatcttaccacggtgctttagccttgactcgccacggcgtaaactcagtt
ggtttaccagggactatcgataatgatattccttataccgactacacgattggctttgat
tctgcttgtcgtactgctatggacgcaattgataagattcgcgacacagcaagtagtcac
caccgcgttttcgttgttaacgtaatgggacgtgaatgtggtgatatcgctatgcgtgtt
ggtgtagctagtggtgcagatgcaattgttattcctgaacgtccatacgacgttaaagaa
attgcagaaactatcactcgtggttttgcagatggcaaagatcatggtatcattgtttta
gcagaaggtgtcatgaccgctgataagtttaaggatgaattacttaaatacggcgatttt
gatgctcgtgctaatgtccttgcgcatatgcaacgtggtggctcaccaacagtcacagat
agagttaatgctactaagatgggtaactatgctgttaagttgcttctcgatgggaagggc
ggtttagctgtcggcatggagaatggtcaacttagtacccacgacattcttgatctgttt
gacggaaaacaccatggcgattatgcgttattggatgtaaatgaagaaatgactaaatat
taa

DBGET integrated database retrieval system