KEGG   Lactobacillus helveticus H10: LBHH_0228Help
Entry
LBHH_0228         CDS       T01959                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lhl00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lhl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
242498..243799
Genome map
AA seq 433 aa AA seqDB search
MPMKQMIIHGGKPLQGDVWIGGAKNSTVALIPASILSRTPVTLEGVPRIADVANLMDLLS
EMDVHCDFGETTLRIDPENIKMSPLPAGKIKSLRASYYFMGALLGRFGKAVVGFPGGDDI
GPRPIDQHIKGFEALGASVKNENDQIIITAPEDGLHGAKIHLKMPSVGATMNIIMASVTA
QGQTIIENAAKEPEIIDLATFLNNMGAVIRGAGTDSIRIEGVDMLKAQIPHTIIPDRIEA
GTYVSLAACIGNGIRIHNIIEEHLDSYLAKVEEMGVVIDADEDSLYVYPAGDLKMVQVKT
NVYPGFATDLQQPITPLLLTAKSGEGVVIDNIYPKRNGHIPQLQKMGADIKVEDNIILAH
PTKQLHGAEVTAGEIRAGACLMIAGLMASGTTVIDKAGNILRGYDRVQEKLRQLGADVTI
KHDPSEPGILDNI
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ttgccaatgaagcagatgattattcatggtggaaagcctctacaaggtgatgtttggatt
ggtggcgccaagaactctacagttgcgctcattccagcatcgattttgtcaagaacacca
gtaactttggaaggcgtcccaaggattgctgatgttgccaacttaatggatttattaagc
gagatggatgtacattgtgattttggagaaactacattacgtattgatccagaaaatatc
aagatgagtccattaccagctggtaagattaagagtttgcgtgcatcgtattacttcatg
ggtgcacttcttggtcgttttggcaaggcagtagtaggcttccctggtggtgacgatatt
gggccacgtcctattgaccaacatattaagggctttgaagccttaggcgccagtgtaaag
aatgaaaatgatcaaattataattacagcaccagaagatggattgcatggggcaaaaatt
catttgaaaatgccatctgttggtgcaacgatgaatattattatggctagtgtaactgcg
cagggtcaaactattattgaaaatgcagctaaagaaccagaaattattgatttagccacc
tttttaaacaatatgggtgcagtaattcgtggtgccggaactgattcaatcagaattgaa
ggtgtggatatgcttaaagcacagattccacatacaattattcctgatcgtattgaagca
ggtacttatgtttctttggccgcttgcattggtaatggtattcgtattcataatattatt
gaagaacacctagattcttacttagctaaagtggaagaaatgggtgtagtaattgacgca
gatgaagattcactttatgtttacccagcaggggacttaaagatggttcaggtgaagacc
aatgtgtatcctggctttgccactgaccttcaacaaccaattaccccacttcttttaact
gctaaatcaggtgaaggcgtagtaattgataatatttatccaaaacgtaacggtcacatc
ccacaattacaaaagatgggggctgatattaaggttgaggataatattattttggctcat
ccaactaagcaacttcatggtgcagaagtaactgctggtgaaattagggcaggagcttgc
ttgatgattgctggattaatggcaagtggtaccactgtaattgataaagctggcaatatt
ttgcgcgggtatgatcgtgtacaagagaagcttcgtcaacttggagctgatgtcacaatt
aaacatgatccaagtgaacctggtatattagacaatatctag

DBGET integrated database retrieval system