KEGG   Lactobacillus helveticus H10: LBHH_0228Help
Entry
LBHH_0228         CDS       T01959                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lhl  Lactobacillus helveticus H10
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lhl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LBHH_0228
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LBHH_0228
Enzymes [BR:lhl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     LBHH_0228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
242498..243799
Genome map
AA seq 433 aa AA seqDB search
MPMKQMIIHGGKPLQGDVWIGGAKNSTVALIPASILSRTPVTLEGVPRIADVANLMDLLS
EMDVHCDFGETTLRIDPENIKMSPLPAGKIKSLRASYYFMGALLGRFGKAVVGFPGGDDI
GPRPIDQHIKGFEALGASVKNENDQIIITAPEDGLHGAKIHLKMPSVGATMNIIMASVTA
QGQTIIENAAKEPEIIDLATFLNNMGAVIRGAGTDSIRIEGVDMLKAQIPHTIIPDRIEA
GTYVSLAACIGNGIRIHNIIEEHLDSYLAKVEEMGVVIDADEDSLYVYPAGDLKMVQVKT
NVYPGFATDLQQPITPLLLTAKSGEGVVIDNIYPKRNGHIPQLQKMGADIKVEDNIILAH
PTKQLHGAEVTAGEIRAGACLMIAGLMASGTTVIDKAGNILRGYDRVQEKLRQLGADVTI
KHDPSEPGILDNI
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ttgccaatgaagcagatgattattcatggtggaaagcctctacaaggtgatgtttggatt
ggtggcgccaagaactctacagttgcgctcattccagcatcgattttgtcaagaacacca
gtaactttggaaggcgtcccaaggattgctgatgttgccaacttaatggatttattaagc
gagatggatgtacattgtgattttggagaaactacattacgtattgatccagaaaatatc
aagatgagtccattaccagctggtaagattaagagtttgcgtgcatcgtattacttcatg
ggtgcacttcttggtcgttttggcaaggcagtagtaggcttccctggtggtgacgatatt
gggccacgtcctattgaccaacatattaagggctttgaagccttaggcgccagtgtaaag
aatgaaaatgatcaaattataattacagcaccagaagatggattgcatggggcaaaaatt
catttgaaaatgccatctgttggtgcaacgatgaatattattatggctagtgtaactgcg
cagggtcaaactattattgaaaatgcagctaaagaaccagaaattattgatttagccacc
tttttaaacaatatgggtgcagtaattcgtggtgccggaactgattcaatcagaattgaa
ggtgtggatatgcttaaagcacagattccacatacaattattcctgatcgtattgaagca
ggtacttatgtttctttggccgcttgcattggtaatggtattcgtattcataatattatt
gaagaacacctagattcttacttagctaaagtggaagaaatgggtgtagtaattgacgca
gatgaagattcactttatgtttacccagcaggggacttaaagatggttcaggtgaagacc
aatgtgtatcctggctttgccactgaccttcaacaaccaattaccccacttcttttaact
gctaaatcaggtgaaggcgtagtaattgataatatttatccaaaacgtaacggtcacatc
ccacaattacaaaagatgggggctgatattaaggttgaggataatattattttggctcat
ccaactaagcaacttcatggtgcagaagtaactgctggtgaaattagggcaggagcttgc
ttgatgattgctggattaatggcaagtggtaccactgtaattgataaagctggcaatatt
ttgcgcgggtatgatcgtgtacaagagaagcttcgtcaacttggagctgatgtcacaatt
aaacatgatccaagtgaacctggtatattagacaatatctag

  All links  
No link information was found.   
DBGET integrated database retrieval system