KEGG   Lactobacillus helveticus R0052: R0052_08080Help
Entry
R0052_08080       CDS       T02217                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lhr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1417639..1419114)
Genome map
AA seq 491 aa AA seqDB search
MTFPKNFLWGGATAANQIEGAYDVDGKGLSVTDITTAGSLDAPRMLTYKLNGKLEKTPAM
PGAGLPEGAVGAIDPNSYYPNHVAIDFYHHYKEDIKMFADMGFKVFRLSIAWTRIFPKGD
EEKPNQAGLDFYRNVFEECKKYGIEPLVTISHYEDPLYLSEKYHDWGDRKMIDMYVKYAK
TLFEEYKGLVKYWLTFNEINTTLLMFNSFGNKVDDDKVYQHAYQKLHYQFVASARAVKLA
HEIDPNYVVGNMICGIVDYPLTPDPKDILLNRHMWEQDIFYCGDAQCKGKYPTFAKRLWK
EHNVHLDITEQDKKDMLEGTVDMYTFSYYMSNVVTTHKIEDKVGGNFAAGAKNPYLKYSE
WGWATDPDGLQYYLEVMYDRYELPLMVVENGLGAVDKISDDGKIHDDYRIDYLRMHIEAM
NRAIEDGVDVRAYTTWGCIDEVSAGTGQMSKRYGFIYVDRDDNGEGTLKRMPKDSFDWYK
KVIASNGEDLG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgacatttccaaagaactttttgtggggcggagcaaccgctgctaaccaaatcgaaggt
gcatatgatgttgatggcaaaggtttatcagtaactgatattactactgctggtagcctt
gatgcaccaagaatgctgacttataagttaaacggtaagttagaaaaaactccagccatg
ccaggtgcaggtttgcctgaaggtgctgttggtgcaattgatcctaatagttattatcct
aaccatgtagcgattgatttttaccaccactacaaagaagatattaagatgtttgccgac
atgggctttaaagtcttccgtctttcaattgcttggactagaattttcccaaagggcgat
gaagaaaagccaaatcaagctggacttgatttttaccgtaacgtctttgaagaatgcaaa
aagtacggtattgaaccattagttacaatttctcactatgaagatccactttacctcagt
gaaaagtaccatgactggggcgatcgtaagatgattgatatgtacgtcaagtacgctaag
actttgtttgaggaatacaagggattagttaagtactggttgacctttaacgaaatcaat
actactttattaatgtttaattcatttggtaataaagtagatgatgacaaggtctaccaa
cacgcttaccaaaaattgcactaccaatttgtagcaagtgctcgtgcagttaagttagct
catgaaattgatccaaactatgtagtcggcaacatgatctgtggtattgttgattatcca
cttactccagatcctaaggatattttgcttaaccgtcatatgtgggaacaagacatcttc
tattgtggggatgcacaatgcaagggtaagtatccaacatttgctaagcgtctttggaag
gaacataacgtacatcttgacatcactgaacaagataaaaaggacatgcttgaaggtact
gttgacatgtacaccttctcttactacatgagtaatgtggtaactacacataagattgaa
gataaagttggcggaaacttcgcagctggtgctaagaacccataccttaagtattctgaa
tggggctgggcaactgatccagacggtttacaatactaccttgaagtaatgtatgatcgt
tatgaattgccattaatggttgtagaaaatggtcttggtgccgttgataagattagtgat
gatggtaagattcatgatgattacagaatcgactacttgagaatgcatatcgaagctatg
aatcgtgctatcgaagatggcgttgatgttcgtgcctacactacttggggctgtattgat
gaagtttcggccggtactggtcaaatgtctaagcgttatggctttatctatgttgaccgt
gatgataacggtgaaggaactttaaagagaatgcctaaggattcatttgattggtataag
aaggttattgcttcaaatggtgaagatttaggttaa

DBGET integrated database retrieval system