KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A1721Help
Entry
LIF_A1721         CDS       T01983                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LIF_A1721 (glpK)
Enzymes [BR:lie01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LIF_A1721 (glpK)
Exosome [BR:lie04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LIF_A1721 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2088179..2089669
Genome map
AA seq 496 aa AA seqDB search
MSDYIIGIDAGTTGIRIFCFNKSGNVISSAYSEFNQHYPKPGWVEHDAEEIWAKTEKLIL
KAIRNGKLSPSKAVAIGITNQRETTVLFDKDTGKPVYNAIVWQCRRTSETCMDLKSKGLE
SFFRKKTGLVLDAYFSGTKIQWILENVKGVKARAEKGKIFFGTIDTYLLYRLTNGKSHKT
DHTNASRTLIYNIEKKEWDKELTQILGIPDSILPETHNSSSLFGRTEKVKGLPDGIPISS
LVGDQQGALFGQLCTEPGEAKNTYGTGCFLLFNTGNNFQISKNNLLTTLGCGPEGKTVYC
LEGSVFIGGAVVQFLRDNLKFFKESKISEKYASSVKKEDDVVFIPAFAGLGAPYWDMNAR
GAILGLTRDTTAEQITRAALKSIALQSYELVEAMENDTGSKLKVLKVDGGATGNSWLMQY
QSDILGKRVVRPSNVDTTVLGAAFLAGLERGFFPSVVDLKKKLKTSKEFSPQMKQPQREK
EIQIWKDSVHRIRTNQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattatatcatcggtatagacgccggaactaccgggattcgaattttttgtttt
aataaatcaggaaacgtaatttccagcgcgtattccgaatttaaccagcattatccgaaa
cctggttgggtggaacacgatgcggaagaaatctgggccaaaactgaaaagctcatatta
aaagcgattcgaaatggaaagttgagtccttctaaagcagtcgcaattggaattacaaat
caaagagaaaccacagtattgtttgataaagataccggaaaacctgtttataatgcgatc
gtatggcaatgtagaagaacttctgaaacctgtatggatcttaaatctaaaggattggaa
tctttttttcgtaaaaaaacgggattggttttagatgcatactttagtggaaccaaaatt
caatggattttggaaaatgtaaaaggtgtaaaagccagagcggaaaaaggaaagatattt
tttggaaccatagatacgtatttactatatcgtttgaccaacggaaaatcgcataagacc
gatcatacgaatgcaagtagaactttgatctacaatatcgaaaagaaagaatgggataag
gaattaactcaaatattaggaattcctgattctattttaccagagacgcataattctagt
tcattgttcggaagaacggaaaaggtaaaaggacttcctgacggaattccaatttcctct
cttgtgggagatcaacaaggggccttatttggccaactttgcacagagcctggggaagcc
aagaacacgtatggaaccggatgttttcttctttttaatactggaaataattttcagatt
tctaagaacaatttacttactaccttaggatgtggaccggaaggaaagactgtttattgt
ttggaaggatccgtttttataggaggcgctgtcgttcaatttttaagagataatctgaaa
ttttttaaagaatccaaaatttccgaaaagtatgcgtcttcggtaaaaaaagaagacgat
gtagtttttattcccgcctttgcagggttaggtgctccttattgggatatgaacgcgagg
ggtgcaattttaggtctgacaagagatactacagcggaacagatcacaagagctgcgctc
aaatcgattgccctccaatcttatgaacttgtagaggcaatggaaaacgatactggttct
aaattaaaagttttaaaagtagacgggggtgcgactggaaattcttggttgatgcagtat
caatctgatatattaggaaaacgtgtagttcgtccttccaatgtagataccacggtatta
ggtgcggcatttttggcgggattagaaaggggattttttccttccgtagtggatctaaaa
aagaaactaaaaacgagtaaggaattttctccacagatgaaacaaccccaaagagaaaaa
gagattcagatttggaaggattctgtccataggatccgaaccaatcaataa

DBGET integrated database retrieval system