KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A2870Help
Entry
LIF_A2870         CDS       T01983                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lie00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3538869..3540416
Genome map
AA seq 515 aa AA seqDB search
MANSQGKYVLSIDSGGSGIRAFLLDRKGNIVERQYEKTPPNIPEAGALEHDPEILWKALL
SLLKKIQKNQQIVKEIIALGICNQRGSFLLWEKSTGKPLTPLISWADVRSHKIAEAMNRN
LIWTIIRVVSTFVGRLTNHPMMIATSMLRFTTDHATCRLKWILDKNPDLKQRCKKGEVLF
GTLDTWFIYKLTGQKQHLTDSSNAVATGMFNPFQLIWNQPILSIFGIPSNLFPEVKDSNG
DFGHTLPEYLGGHSIPIRASIGDQMAALFGHCCFERGEVKISQGSGAFVDINIGPKAKLS
KRGLFPMIAWRIDGNTTYMLEGYVATAGTLIDWLGQGIGLSDTPKVLNELAAQSEDTEGV
VFIPTPTGARFPYFNPRAKASVIGLSLASHRRHVARAVLEGISLSLYEILEGIQRDTKVE
IKDIKVDGGVSQSDILLQCLSDFSNVRVNRSPEPDMTATGTAYLAGLAVGFWKNLDELKN
LQKGYKSFEPKMNPTKRVQKIQRWKKAVTATLSIE
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggctaattcacagggcaaatacgtcctttccatcgacagtgggggaagtggaattcgt
gcgtttttattagatcgaaaaggtaatatagtcgaaaggcaatatgaaaaaactcctcct
aatattcccgaagcaggtgctttagaacacgatccagaaatcctatggaaggcccttctt
tctcttttaaaaaagatccaaaaaaatcagcaaattgtaaaagaaattatcgcattagga
atttgtaatcaacgcggctcctttcttctctgggaaaaatccacaggaaagccattaact
cctttgatcagttgggcggacgttcgttctcataaaattgcagaagcgatgaatcgaaat
ctaatctggacaatcatccgtgttgtatctacgtttgtaggaagattgacaaaccatccg
atgatgatcgccacttccatgctacgatttacgacagatcacgcaacttgtagattaaaa
tggattttagacaaaaatccagatctaaaacagagatgcaaaaaaggtgaagttcttttt
ggtacgttagatacttggttcatttataaacttaccggtcaaaaacaacatctcaccgat
tcgtcaaatgcagttgctacgggaatgtttaatccttttcaattgatctggaaccaaccg
attctttcaatattcggaattccttctaatttatttccggaagtaaaagatagcaacgga
gacttcggtcatactttgccagaatatttaggaggacattcgattccaatcagagcttcg
attggagatcaaatggcggctctatttgggcattgttgttttgaaaggggcgaagtaaaa
atttctcaaggttccggggcatttgtggatattaacatagggcccaaagcaaaactttcc
aaacgcggtctttttccaatgatcgcttggagaatagacggcaataccacatatatgtta
gaaggttatgttgcaaccgctggaaccctcatagattggttaggacaaggaatcggactt
tccgacactcctaaagttttgaacgaacttgcggcccaatcggaagatacagaaggagtc
gtttttattccaactcctacgggagcccgttttccttatttcaatcctcgtgccaaggca
tccgtgatcgggctttctctagcatctcatagaagacacgttgcaagagccgtcctagaa
ggaatttctctcagtctctatgaaattttagaaggaattcaacgagatacaaaagttgaa
atcaaagacattaaagtggacggcggtgtatctcagtctgatattcttcttcaatgtctt
tcagatttttcgaatgtaagagtaaatcgttctcccgaaccagatatgactgcaacagga
acggcgtatcttgctggtttggcagttggcttttggaaaaatttagatgaattgaagaat
ttacaaaaaggttataaatctttcgaaccgaagatgaacccaacaaaaagggttcaaaaa
attcaacgttggaaaaaagcagttaccgcaactctttccatcgaatga

DBGET integrated database retrieval system