KEGG   Lawsonia intracellularis PHE/MN1-00: LI0193Help
Entry
LI0193            CDS       T00354                                 

Gene name
galU
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:lip00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lip00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lip00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lip00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
242878..243798
Genome map
AA seq 306 aa AA seqDB search
MYLLTNNIFTIGALMNIRKVVVPVAGWGTRSLPASKNIPKEMLPIYNKPVVQYVVEEAML
AGVQDVIFVTNRDKSVIEDFFDYNPQLESILERSGKYELLKVIQNVAEMVNIMSVRQKRQ
LGLGHAVLCAKEIVRDEPFAVMVGDDLMFGENAGMDRLIQIAREQNKPVIGVREVPEDKI
NRYGIISGTEISTDVYDITEMIEKPTLGSTQSRLAIVGRYLLTPDIFEYLEKVTPGHGGE
IQLTDALAALAQEKGMLAVKLGGLRFDAGDWVDYLSANVYFAMMDETLKDDLFNKLNQIL
HISEKQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgtatctattaactaataatatatttacaataggagctttaatgaacattcgtaaagtt
gtcgttcctgttgctggatggggtactcgttcattacctgcaagcaaaaatatccctaaa
gaaatgttgccaatatataataaaccagtcgttcaatatgttgtagaagaagccatgctt
gcaggtgttcaggatgttatttttgttaccaatagagataaaagcgttattgaagatttt
tttgactataatccgcagttagaaagtatacttgagagatctggaaaatacgaacttcta
aaagtcattcaaaatgttgctgaaatggttaatattatgtctgtccgtcaaaagcgacaa
ttaggacttggacatgctgttctttgtgcaaaagaaattgttcgtgatgaaccttttgct
gttatggttggtgatgacttaatgtttggagaaaatgctggcatggatagacttattcaa
attgcccgtgagcagaataagcctgttattggagtccgtgaagttccagaagacaaaatt
aatagatatggtattattagtggtacagaaattagtactgatgtgtatgatattacagaa
atgatagaaaaaccaaccttaggttctacacagtcacgtcttgctattgttggtcgttat
ttattgacaccagacatatttgaatatttagaaaaagtaacaccaggacatggtggagaa
attcaacttacagatgcacttgcagcattagcacaagaaaaaggtatgctagctgttaaa
cttggaggacttcgttttgatgctggtgactgggtggattatctttcagcaaacgtatat
tttgcgatgatggatgaaacactaaaagatgatctttttaataaattaaatcagatcctt
cacatttcagaaaaacaataa

DBGET integrated database retrieval system