KEGG   Lawsonia intracellularis PHE/MN1-00: LI0193Help
Entry
LI0193            CDS       T00354                                 

Gene name
galU
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LI0193 (galU)
   00052 Galactose metabolism
    LI0193 (galU)
   00500 Starch and sucrose metabolism
    LI0193 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LI0193 (galU)
Enzymes [BR:lip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LI0193 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
242878..243798
Genome map
AA seq 306 aa AA seqDB search
MYLLTNNIFTIGALMNIRKVVVPVAGWGTRSLPASKNIPKEMLPIYNKPVVQYVVEEAML
AGVQDVIFVTNRDKSVIEDFFDYNPQLESILERSGKYELLKVIQNVAEMVNIMSVRQKRQ
LGLGHAVLCAKEIVRDEPFAVMVGDDLMFGENAGMDRLIQIAREQNKPVIGVREVPEDKI
NRYGIISGTEISTDVYDITEMIEKPTLGSTQSRLAIVGRYLLTPDIFEYLEKVTPGHGGE
IQLTDALAALAQEKGMLAVKLGGLRFDAGDWVDYLSANVYFAMMDETLKDDLFNKLNQIL
HISEKQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgtatctattaactaataatatatttacaataggagctttaatgaacattcgtaaagtt
gtcgttcctgttgctggatggggtactcgttcattacctgcaagcaaaaatatccctaaa
gaaatgttgccaatatataataaaccagtcgttcaatatgttgtagaagaagccatgctt
gcaggtgttcaggatgttatttttgttaccaatagagataaaagcgttattgaagatttt
tttgactataatccgcagttagaaagtatacttgagagatctggaaaatacgaacttcta
aaagtcattcaaaatgttgctgaaatggttaatattatgtctgtccgtcaaaagcgacaa
ttaggacttggacatgctgttctttgtgcaaaagaaattgttcgtgatgaaccttttgct
gttatggttggtgatgacttaatgtttggagaaaatgctggcatggatagacttattcaa
attgcccgtgagcagaataagcctgttattggagtccgtgaagttccagaagacaaaatt
aatagatatggtattattagtggtacagaaattagtactgatgtgtatgatattacagaa
atgatagaaaaaccaaccttaggttctacacagtcacgtcttgctattgttggtcgttat
ttattgacaccagacatatttgaatatttagaaaaagtaacaccaggacatggtggagaa
attcaacttacagatgcacttgcagcattagcacaagaaaaaggtatgctagctgttaaa
cttggaggacttcgttttgatgctggtgactgggtggattatctttcagcaaacgtatat
tttgcgatgatggatgaaacactaaaagatgatctttttaataaattaaatcagatcctt
cacatttcagaaaaacaataa

DBGET integrated database retrieval system