KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_0372Help
Entry
uc509_0372        CDS       T02415                                 

Gene name
asnB
Definition
Asparagine synthetase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lli00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    uc509_0372 (asnB)
Enzymes [BR:lli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     uc509_0372 (asnB)
Peptidases [BR:lli01002]
 Cysteine Peptidases
  Family C44
   uc509_0372 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
370101..371675
Genome map
AA seq 524 aa AA seqDB search
METSDLTIEEFKSNLELIEHRGPDDQQHVRDTLGNDFGFCRLSIMDLSDLGRQPFGLNGK
RVMCNGEIYNFLSLRKFLETKGYKFTGDSDCEVLLPLFETTGIETMVKMLDAEFAFVLVD
ENTGEIFAARDPFGIRPLFYGYNKVTGKISFSSEAKALISTCKDVTPFPPGYYYTGGEFY
VYNDIAEVSTIVEEPLAEISGHIRRKLERAVKKRLHADAPMGYLLSGGLDSSLVCAIAAK
ELESPIKTFAIGMETDPIDLKYAREVADFLRTDHTEILMTKEDVLSAVREVIWHLETWDI
TTIRASIGMYLICKYIHENTELKVLMTGEVSDEMFGYKYTDFAPSAGAFQKEAQKRVHEL
YMYDVLRADRCLAAHSLEARVPFADLDFATYVMSINPSRKLNTYGKGKYLLRHAFEGTEL
LPDEILFREKAAFSDAVGHSMVDYLKEFADEKYSDEDLAKASEKYPKHTPFTKESLMYRE
IFSEFYPGYEDWIIDFWMPNPDWVGADVKDPSARVLSNYGDSGK
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggaaacatctgacttaacgatagaagagtttaaaagcaatttggaactgattgaacat
cgaggaccagacgaccaacaacatgttcgtgatactttgggaaatgattttggtttttgc
cgactttcaatcatggatttgtcagacttggggcgtcagccctttggactgaacggtaaa
agagtcatgtgtaatggtgaaatttataactttttaagccttcgtaagttcttggaaact
aagggatataaatttacaggagattctgattgtgaagtgcttttacctctttttgaaacc
acaggaatcgaaacaatggtcaaaatgcttgatgctgaatttgcttttgtcctagttgat
gaaaatactggtgagatttttgcggctcgtgacccctttggaattcgtccacttttttat
ggttataataaagttacgggaaaaatttctttctcttctgaagctaaggcccttatttca
acctgtaaagatgtgacgccttttccaccaggttattattatacgggtggtgaattttat
gtttataatgatattgcggaagtttcaacgattgttgaagaacctttggctgaaatttca
ggacatatccgtcgcaaattggaacgtgcagtaaaaaaacgtcttcatgcagatgctcca
atgggttatctcttgtcaggcggtttagattcatcattggtctgtgccattgcagctaaa
gaattagaaagtccaatcaagacctttgcgattggaatggaaacagacccgattgatttg
aaatatgctcgggaagtagcagatttcttacggactgaccataccgaaattttgatgaca
aaagaagacgtactttcagcagttcgtgaagtgatttggcatttggaaacttgggatatc
acgacgattcgggcttctattgggatgtatttaatctgtaagtatattcatgagaataca
gagctgaaagttttgatgaccggtgaggtttccgatgaaatgttcggctataaatatact
gactttgctccatcagctggggcctttcaaaaagaagcacaaaagcgagtacatgaacta
tatatgtatgatgtcctgcgggctgaccgttgcttagcggctcattctcttgaagctcgc
gttccatttgctgacttggactttgcgacttatgtcatgtccatcaatccgagtagaaag
ctgaatacttatggcaaaggaaaatatctcttacgccatgcttttgaaggaacggagcta
ttgccagacgagattttatttagagaaaaagcggctttttctgatgctgttggtcattcc
atggtcgactatttaaaagaatttgctgacgaaaaatattctgatgaagatttagcaaag
gctagtgaaaagtatccaaaacatacaccatttaccaaagaatccttgatgtatcgggaa
attttttcagaattttacccaggttatgaagattggattattgatttttggatgccaaac
cctgattgggtgggagcagatgttaaagatccatcagcacgcgtcttgtcaaattatggt
gattccggaaaataa

DBGET integrated database retrieval system