KEGG   Legionella longbeachae: LLO_0305Help
Entry
LLO_0305          CDS       T01183                                 

Gene name
recR
Definition
Recombination and repair protein recR
Orthology
K06187  
recombination protein RecR
Organism
llo  Legionella longbeachae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:llo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LLO_0305 (recR)
DNA repair and recombination proteins [BR:llo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LLO_0305 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(341639..342232)
Genome map
AA seq 197 aa AA seqDB search
MDILTRLVEALRCLPGVGPKSAQRMVFHLLQHQRQRGLHLASCLEQAMNQIQHCERCANY
TEHKLCALCQNSDRDSSLLCVVESPADVSAIEQSNAFQGKYFVLMGKISPLDGLGPDDIG
LPRLKRLIIQENIKEVILALSPSVEGQTTIHFIHQLLRDQPVNMTQLAHGIPSGGELEFL
DGNTIGNALRNRAIIHV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggatattttaactcgcttggtcgaagcactccgctgtcttccaggcgtaggtccaaaa
tctgcgcagcgtatggtttttcacttgctccagcatcaacggcagcgagggttgcacctt
gcttcttgtttggagcaagcaatgaatcaaatacaacattgtgaacgttgtgctaattac
acagagcacaagctttgtgctctctgccaaaactcagatagagactcctctttactttgt
gtcgtagaaagtccagctgatgtatctgccatagagcagagtaatgcctttcaaggtaaa
tatttcgtccttatgggaaaaatctctccacttgatggattagggcccgatgacataggc
cttccacgacttaaaagacttattattcaagagaatattaaagaagtaatattagcgttg
agtcctagtgtagaaggacaaacgaccatccattttattcatcaacttttgcgtgatcag
ccagtaaatatgacgcaattggctcatggtataccgtcaggcggagagttagaatttttg
gatggtaatactataggaaacgctcttcgtaacagagcaataattcatgtttaa

DBGET integrated database retrieval system