KEGG   Leishmania major: LMJF_36_2320Help
Entry
LMJF_36_2320      CDS       T01014                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lma  Leishmania major
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMJF_36_2320
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMJF_36_2320
   00052 Galactose metabolism
    LMJF_36_2320
   00500 Starch and sucrose metabolism
    LMJF_36_2320
   00520 Amino sugar and nucleotide sugar metabolism
    LMJF_36_2320
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    LMJF_36_2320
Enzymes [BR:lma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LMJF_36_2320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
36:931395..932630
Genome map
AA seq 411 aa AA seqDB search
MPLTDEIQLEQLAPTIKGDASWSTGPIYVVCDVGGTNARVGFARAAQHEGSGLHIIYVRF
RVTKRDIRQLLEFFDEVLQHLKKNLPYRAGPFLRRVASGAVSVPGPLTNGQLAGPFSNLK
GIARLADYPVELFPRGRSALLNDLEAGSYGVLALSNAGMLSDYFKVMWKGTQWDALSEGK
PVGSTIGHGRCMVVAPGTGVGSSLIHYVGVSDSYVVLALECGCLSMSWCANEDSKYVQAL
AGYMASKARVKGLDSTVAPIWEAAANGSGLEFNYAYEKEGPKASAPLKSAPEVAKLAKAG
SDPAAVAAMDRLYKNLIGLTAETTMQFLPLTCVLMGDSIVSNSFYFDNPENVKKLQARIN
EHTMERQLKFLSRTTFLRQVRSVNINLLGCLEFGSQLSNRADQLAPTKSNL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcacagacgagatccaactcgagcagctggcccccaccatcaagggcgacgcc
tcctggtccaccggccccatctacgttgtgtgtgatgttggcggcacgaacgcgcgcgtc
ggctttgctcgagcggcgcagcacgagggaagcggcctgcacatcatctatgtccgcttc
agggtgacgaagcgcgacatccgccagctgctcgagttcttcgatgaggtgctgcagcac
ctgaagaagaacctgccctaccgcgctggcccctttctgcgtcgtgtcgcgtccggtgcc
gtgagtgtgccgggacctctcaccaacggacagctcgcgggccccttcagcaatctgaag
ggcattgcacggctggcggactacccggtggagctgtttccaaggggccgcagcgcgctt
ctgaacgatctagaggctggctcctatggcgtgctggcactgagcaacgccggcatgctg
tccgactacttcaaggtcatgtggaagggcacgcagtgggacgcgctgtcggaaggcaag
cccgttggcagcaccatcggccacggccgctgcatggtcgtggcccccggcaccggcgtc
ggctcctctctcatccactacgtgggtgtgtcggacagctatgttgtgctggcgctggag
tgcggctgtttgtccatgtcttggtgcgccaatgaggactcgaagtacgtgcaggcactt
gccggctacatggcatccaaggcacgtgtgaagggcctggactcgacggtggcccccatc
tgggaggctgcggcaaatggtagcgggttggagttcaactacgcgtatgagaaggagggg
ccgaaggcatccgctcccctcaagtccgctcccgaggtagccaagctcgccaaggctggc
agcgacccggccgccgtggccgccatggaccgtctctacaagaacctcataggcctcaca
gctgagacaacgatgcagttcctgccgctgacatgtgtgctgatgggcgacagcatcgtt
tccaacagcttttatttcgataacccagagaatgtgaagaagctgcaggctcgcataaac
gagcacacgatggagcggcagttaaagttcttgagtcgcaccacgttccttcgccaggtg
cgcagtgtgaacatcaacctgctgggctgccttgaatttggtagccagctctccaaccgg
gcagatcagttagcgccaaccaagtccaacttgtga

DBGET integrated database retrieval system