KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1064Help
Entry
LEUM_1064         CDS       T00411                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LEUM_1064
Enzymes [BR:lme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LEUM_1064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1062077..1064128
Genome map
AA seq 683 aa AA seqDB search
MTDTLQISKFLHGGDYNPEQWIDNSEIINRDFTLFKQSKINTFTIGIFSWAKIEPKEGVY
DFEWLDNIFDRVEQQNGNIILATPSGARPRWMSEKYPEVLRTNEQGQKLLFGERHNHCLS
SPVYRAKTKSINYQLAKRYGHRKSLILWHISNELGGDCHCELCQEKFREWMKNKYKTIDN
LNRLYWSSFWSHQYNNWDDIHSPSTLGDTTSLILNLDWKRFVTDQTIDVFENEVKPLREV
TPNIPVTTNFMGGNPPESSIFMDLDYQKFSKHVDVISWDSYPNWSNDYETTETLAMKTAL
MNDVMRGLKHDSYLIMESTPSQVNWHPFNKSKRPGMHEMGSLQQIAHGANSVLYFQLHQS
RGSSEMFHGAVVTHSLSNRTRVFKDVSLVGKDLEKLQPLLKSKYTHTKIAIVFDYDNVWA
LDDARNYSDQTKKYWHTIQSHYSVFWQNNIPVDIISAQDDLSPYTLVIDPMHFMMDIEYM
EKIEKYVSSGGNLVGTYMTGVVDKNYLAYLGGWPERLQRIYGLSYVETDTLYPKQTNTII
WEDNEYKVIDYADVFEQKGATSLAYYEDDFYAQSPALTKNDLGSGTAMMIAGRTEKAFLN
KFYSKLIDKYSLRDSQIPFENADAHLSVQVRQDERQKYYFITNYTDNKQIALFKDSYTEM
LSGNSLNGSTTLEPYQVIVATKD
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacattacaaatttcaaagtttctacatgggggcgactataatcccgaacaa
tggattgataattcagaaatcattaatcgcgattttacattgtttaagcaatccaaaatc
aacacgttcacaataggaattttttcttgggcaaaaattgaaccaaaagaaggagtttac
gattttgaatggttagataatatttttgatagggttgaacaacaaaacgggaatattatt
ttagctactccaagtggcgccagacctagatggatgtctgaaaaatatccggaagttcta
cgaacgaatgaacaaggacaaaaacttttattcggggaacgtcataatcattgtttatca
tcgcctgtttaccgcgcaaagacgaagtcaatcaattaccagcttgcaaagagatatggt
catcgcaaaagtttaattctttggcatatttctaatgagttgggaggtgattgccactgt
gaattgtgccaagaaaaatttcgtgagtggatgaaaaataaatataagacgattgataac
ttaaataggctatattggtcatcattttggagtcatcaatataataattgggatgacatt
cattcaccttcgacactgggtgatactacttctctaattctgaatttggactggaaacgt
tttgtgacggaccaaacaattgatgtctttgaaaatgaagtcaaaccattacgagaagtg
actccaaatattcctgttacaacaaattttatggggggaaatcccccagaatcaagcatt
tttatggatttagattaccaaaaattttctaaacatgtggatgtgattagttgggattca
tatcctaattggtccaatgattatgaaactacggaaactttagctatgaaaacggctcta
atgaatgatgttatgagggggttgaagcacgattcttaccttataatggaaagtactcct
tctcaggttaattggcaccctttcaataaatcaaagcggccaggaatgcatgagatgggc
agtctgcaacagatagcacatggagcaaactcagtactttattttcagttacaccaatca
cggggatcttcagaaatgtttcacggcgctgttgtgacacatagtttgagcaatcgtaca
cgagttttcaaagatgtaagtttagtaggaaaagatctagaaaaattgcaaccgttactc
aaatctaaatacacacacaccaaaattgcaattgtattcgattatgacaatgtatgggca
ttagatgatgcaagaaattattcggatcaaacaaagaaatattggcatactattcagagt
cactatagtgttttttggcagaataatatacccgttgatattatttctgctcaagatgat
ttatccccttatacacttgtgatagatccgatgcacttcatgatggacatcgagtatatg
gaaaaaattgaaaaatatgtgagttcgggaggcaatcttgttggtacttatatgacaggc
gtggttgataaaaattatttagcatatttaggtgggtggccagaaagactgcaaagaatt
tatggtttgtcttatgttgaaactgataccctttacccaaaacaaactaataccatcata
tgggaagacaacgaatataaagtaatcgactatgctgatgtttttgaacagaaaggcgct
acctcactcgcttattatgaagatgatttttatgctcaaagcccagccttaacaaaaaat
gatttgggttctggcaccgctatgatgattgctggcagaacggaaaaagcttttttaaat
aaattttacagtaaattaattgataaatactcacttcgtgattcacaaattccttttgaa
aatgctgatgcacatctaagtgtacaagttcggcaggatgagcgtcaaaaatattatttc
attacaaattataccgataataaacaaattgccttgtttaaggatagctatacggagatg
ttgtcagggaatagtttaaatggaagcactacattggaaccatatcaggttatcgtagca
acaaaggactga

DBGET integrated database retrieval system