KEGG   Listeria monocytogenes FSL R2-561: LMKG_00637Help
Entry
LMKG_00637        CDS       T01985                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMKG_00637
   01230 Biosynthesis of amino acids
    LMKG_00637
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMKG_00637
   00030 Pentose phosphate pathway
    LMKG_00637
   00051 Fructose and mannose metabolism
    LMKG_00637
   00052 Galactose metabolism
    LMKG_00637
  Energy metabolism
   00680 Methane metabolism
    LMKG_00637
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LMKG_00637
Enzymes [BR:lmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LMKG_00637
Protein phosphatases and associated proteins [BR:lmg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LMKG_00637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1630590..1631549)
Genome map
AA seq 319 aa AA seqDB search
MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDL
LHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTI
GIPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWS
GLAGGAEAIIVPEESFNMDDVVDRLNKGRERGKKHSIIVVAEGVMSGNEFAKQLAEYGDY
HARVTVLGHVQRGGSPTAFDRVLASRLGARSVELLLENRGGLAVGIRENRIVENDISEIL
KEKHTLDQKLFDLASILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcaattttaacaagtggaggagacgctccaggaatgaatgcagccact
cgcgctgttgtacggaaagcaatctatgaaggacttgaagtttacggtattaactatggc
tttttagggctagtcaatggcgatattcgtaaactagaattaggttctgttggtgattta
cttcaccgcggaggtacattcctttattccgcaagatatcctgaattcgctacagaagaa
ggacaacttaaaggaattgaacaattgaaaaaacatcaaatcgatggcctagttgttatt
ggtggagatggttcttaccacggagcggaagcacttacaaaacgtggattcccaaccatt
ggtatcccaggaactattgataatgatatttctggaactgattttactattggttttgat
acagcgttaaatactgttcttgatgcacttgataaaatccgcgatacagctacaagtcac
gaacgtactttcattattgaagttatgggtcgcgacgctggtgatatcgctctttggtct
ggtcttgctggtggcgctgaagctatcatcgttccagaagaaagttttaatatggatgat
gtcgtggatcgtttgaacaaaggtcgcgaacgtggcaaaaaacatagtattatcgtcgta
gctgaaggcgtaatgtctggtaatgaatttgctaaacaattagctgaatatggcgattat
catgcacgtgtaactgttcttggacacgttcaacgtggtggtagcccgactgcatttgac
cgtgtacttgcaagtcgtcttggtgcacgttcagtagaattattgctagaaaaccgcgga
ggattagctgttggaatccgtgaaaatagaattgtcgaaaatgacattagtgagattttg
aaagaaaaacacactcttgatcaaaaattatttgatcttgcatcaattttgtcgatttaa

DBGET integrated database retrieval system