KEGG   Listeria monocytogenes EGD-e: lmo2840Help
Entry
lmo2840           CDS       T00066                                 

Definition
hypothetical protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmo  Listeria monocytogenes EGD-e
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    lmo2840
Enzymes [BR:lmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     lmo2840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2927390..2928631)
Genome map
AA seq 413 aa AA seqDB search
MEMDPNTDLSSVTRPRATPVLTTFQFDSGKVGHIWTTFSEDQIDLNFACPEVLYKMIDVL
MFYLEEGAEYVRLDAVGFMWKVPGTSSIHLEETHEIVKLFRDLVDIAAPGTIIITETNVP
HVDNISYFGNGEKEAHMVYQFPLPPLVLHAIHHGNAKFLRNWAKNLELPEGKRTFFNFLA
SHDGIGLNPVRGIIPEAEILALVNDLEEEGALVSYKQNPDGSKSPYEINVTYMDALSKQA
DTDDLRLARFLVAHAVLMSIPGVPAVYVQSILGSRNDYLGVEATSHNRSINRKKYDLAEI
TAELEQRGSLRKATYDALTKLISTRKAESLFHPEIPMEVLESTAELFVVKRSSDAESIIL
IHNLSEKEVSYSLDSGVYTNLYKGSTVTGSDSIKLSGYEFCWLKTKNYREEQK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtggaaatggatccaaatacggaccttagttcggttacaagaccacgcgcgacaccagta
ctgacaacatttcaatttgattcaggaaaagtagggcatatttggacgacgtttagtgag
gatcagattgatttgaactttgcttgtccggaagtgctttataagatgattgatgtttta
atgttctatctagaagaaggagcagaatatgtgcgacttgatgcggttggatttatgtgg
aaggtgccgggaacaagctcgattcacttggaagagacgcatgaaatcgtgaaattattt
agagatttagtagacattgcagctccggggacgattattattaccgaaaccaatgtgccg
catgttgataatattagttattttggaaatggtgaaaaagaagcgcatatggtttatcaa
ttcccgcttccaccacttgtgctccatgctatccatcatggtaatgcaaaattcctccgt
aactgggcgaagaatttagagctaccagaaggcaagcggacattctttaatttccttgcc
tcacatgatgggattgggttaaatccagtgcgcggaattattccagaagctgagattttg
gctttagtgaatgatttggaggaagaaggtgcgctcgtttcttacaagcaaaatccagat
ggttctaagagtccttatgaaataaacgtgacgtacatggatgcgctaagtaaacaggcg
gacacagatgatttgcgacttgcaagattccttgtggctcatgcagtattgatgtctatc
ccaggcgttccagccgtttatgttcaaagtattttaggaagccgcaatgattatttaggc
gtagaagcaacaagtcacaatcgctctattaatcgaaaaaaatacgacttggcggaaatt
acagcagagttggaacaaagaggctccttacgaaaagcaacttatgatgcgctaacgaaa
ttaattagcacacgaaaagcggaatcacttttccatccagaaataccgatggaagtttta
gaatctacggcggaattgtttgttgttaaacgttcatccgacgcggaatcgattatattg
attcataatttatcagaaaaagaagtgagttattcactagacagcggtgtttatacaaat
ctttataagggctccacagtaactgggagcgattccataaagcttagtggctatgaattc
tgctggctaaaaaccaaaaattacagggaggaacaaaaatga

DBGET integrated database retrieval system