KEGG   Listeria monocytogenes EGD-e: lmo2840Help
Entry
lmo2840           CDS       T00066                                 

Definition
(RefSeq) sucrose phosphorylase
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
lmo  Listeria monocytogenes EGD-e
Brite
Enzymes [BR:lmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     lmo2840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 986521
NCBI-ProteinID: NP_466362
Pasteur: LMO02840
UniProt: Q8Y3J5
Position
complement(2927390..2928631)
Genome map
AA seq 413 aa AA seqDB search
MEMDPNTDLSSVTRPRATPVLTTFQFDSGKVGHIWTTFSEDQIDLNFACPEVLYKMIDVL
MFYLEEGAEYVRLDAVGFMWKVPGTSSIHLEETHEIVKLFRDLVDIAAPGTIIITETNVP
HVDNISYFGNGEKEAHMVYQFPLPPLVLHAIHHGNAKFLRNWAKNLELPEGKRTFFNFLA
SHDGIGLNPVRGIIPEAEILALVNDLEEEGALVSYKQNPDGSKSPYEINVTYMDALSKQA
DTDDLRLARFLVAHAVLMSIPGVPAVYVQSILGSRNDYLGVEATSHNRSINRKKYDLAEI
TAELEQRGSLRKATYDALTKLISTRKAESLFHPEIPMEVLESTAELFVVKRSSDAESIIL
IHNLSEKEVSYSLDSGVYTNLYKGSTVTGSDSIKLSGYEFCWLKTKNYREEQK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtggaaatggatccaaatacggaccttagttcggttacaagaccacgcgcgacaccagta
ctgacaacatttcaatttgattcaggaaaagtagggcatatttggacgacgtttagtgag
gatcagattgatttgaactttgcttgtccggaagtgctttataagatgattgatgtttta
atgttctatctagaagaaggagcagaatatgtgcgacttgatgcggttggatttatgtgg
aaggtgccgggaacaagctcgattcacttggaagagacgcatgaaatcgtgaaattattt
agagatttagtagacattgcagctccggggacgattattattaccgaaaccaatgtgccg
catgttgataatattagttattttggaaatggtgaaaaagaagcgcatatggtttatcaa
ttcccgcttccaccacttgtgctccatgctatccatcatggtaatgcaaaattcctccgt
aactgggcgaagaatttagagctaccagaaggcaagcggacattctttaatttccttgcc
tcacatgatgggattgggttaaatccagtgcgcggaattattccagaagctgagattttg
gctttagtgaatgatttggaggaagaaggtgcgctcgtttcttacaagcaaaatccagat
ggttctaagagtccttatgaaataaacgtgacgtacatggatgcgctaagtaaacaggcg
gacacagatgatttgcgacttgcaagattccttgtggctcatgcagtattgatgtctatc
ccaggcgttccagccgtttatgttcaaagtattttaggaagccgcaatgattatttaggc
gtagaagcaacaagtcacaatcgctctattaatcgaaaaaaatacgacttggcggaaatt
acagcagagttggaacaaagaggctccttacgaaaagcaacttatgatgcgctaacgaaa
ttaattagcacacgaaaagcggaatcacttttccatccagaaataccgatggaagtttta
gaatctacggcggaattgtttgttgttaaacgttcatccgacgcggaatcgattatattg
attcataatttatcagaaaaagaagtgagttattcactagacagcggtgtttatacaaat
ctttataagggctccacagtaactgggagcgattccataaagcttagtggctatgaattc
tgctggctaaaaaccaaaaattacagggaggaacaaaaatga

DBGET integrated database retrieval system