KEGG   Listeria monocytogenes SLCC5850: LMOSLCC5850_1376Help
Entry
LMOSLCC5850_1376  CDS       T02223                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
lmoc  Listeria monocytogenes SLCC5850
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:lmoc00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1344691..1345833
Genome map
AA seq 380 aa AA seqDB search
MKKIILLGATGSIGTQTLAIIRENPEKFQVVALSFGRNMERGRAIIKEFKPKMVAVWHTR
DRVTLEAEFPNVKFFNGLEGLREVATYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIAN
KETLVTAGHLVMRSAKEKSISLLPVDSEHSAILQALNGENPERIEKLVLTASGGSFRDKT
REQLSAVTVKEALKHPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVDYDDIEVVIQRES
IIHSMVQFVDGSFIAQLGTPDMRMPIQYALTYPDRLYIPYEKEFRITDFSALHFEKVDYE
RFPALKLAYNAGKIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENAMNRHTSISNP
DLDTILQVDQETRAYVKTLL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattttgctaggtgcaactggttcaattggaacacaaacgcttgcaatc
attcgcgaaaatcctgaaaaatttcaagttgttgcgcttagttttgggcgtaatatggaa
cgtggtagggcgattataaaagagtttaaaccaaaaatggtcgctgtttggcatacgaga
gatcgtgttaccttagaagcagaattcccaaatgtgaaattttttaatggtttagaagga
cttagagaagtagcgacctatttagatggggacgttcttttaaatgcagttatggggagc
gttggactacttcctacattagatgcaatcgaagctgggaaggccattgcaatagctaat
aaagaaacacttgtcacggctggacatttagttatgcgttcggcgaaagaaaagagcatt
tctctattacccgttgatagtgaacattctgctattttacaagcattaaacggagaaaat
ccagaaagaatagaaaaactagttcttacagcgagcggtggaagcttccgagataagacg
agggagcaactcagcgcggttacggtgaaagaagcgttaaaacatccaaactggaatatg
gggaataaattaacaattgattcagcaacgatgtttaacaaaggtttggaagtgatggag
gcgcactggctgtttggtgtagattacgatgatattgaggtagttatccagcgcgaaagt
attatccattctatggttcagttcgtggatggaagtttcatcgcacaacttggaacgcca
gatatgcggatgccaattcaatatgctttaacctatcccgacagactctatataccgtat
gaaaaagaattccggatcactgatttttccgcacttcattttgaaaaagtggattatgaa
agatttccggcattgaaactcgcgtataatgctggtaaaataggtggaacaatgccgaca
gttttgaatgcggcaaatgaaattgctgttgctggctttttaaatggacaggtagctttt
tataatattgaagcacttgttgagaatgcaatgaatcgtcatactagtatttctaatcct
gacttggatacgattttacaagtcgatcaagaaacacgcgcgtatgtaaagacactttta
tag

DBGET integrated database retrieval system