KEGG   Listeria monocytogenes La111: BN418_3368Help
Entry
BN418_3368        CDS       T02512                                 

Definition
Putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmoe  Listeria monocytogenes La111
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmoe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN418_3368
Enzymes [BR:lmoe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     BN418_3368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2759402..2761102)
Genome map
AA seq 566 aa AA seqDB search
MTNLRKRLSRLYAEDVVDSLAARIEARVQQTQQRKLTRKDQWDEKDIVLITYGDQFKEES
QKTLTTFKKMYDSYLKSAFEIVHFLPFYPYSSDDGFSVIDYKAVNPELGDWKDIKEMEKS
ARLMFDFVCNHMSAKSDWFKRYLAGDEEFRNFFVEMDPKTDLSSVTRPRATPVLTPFQFD
SGKVGHIWTTFSEDQIDLNFACPEVLYKMIDVLMFYLEEGAEYVRLDAVGFMWKVPGTSS
IHLEETHEIVKLFRDLVDIAAPGTIIITETNVPHVDNISYFGNGEKEAHMVYQFPLPPLV
LHAIHHGNAKFLRNWAKNLELPEGKRTFFNFLASHDGIGLNPVRRIIPEAEILALVNDLE
EEGALVSYKQNPDGSKSPYEINVTYMDALSKQADTDDLRLARFLVAHAVLMSIPGVPAVY
VQSILGSRNDYLGVEATSHNRSINRKKYDLAEITAELEQRGSLRKATYDALTKLISTRKA
ESLFHPEIPMEVLESTAELFVVKRSSDAESIILIHNLSEKEVSYSLDSGVYTNLYKGSTV
TGSDSIKLSGYEFCWLKTKNYREEQK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaagaaaacgactttcgcggttatatgccgaagatgtggtagatagtttg
gcagctagaatcgaagcacgggtacagcaaacgcaacaacgaaagttaacgcgaaaagat
cagtgggacgagaaagatattgttttaattacatatggggaccaatttaaagaggaatcc
caaaaaacgttaacaacttttaaaaaaatgtatgatagttatttaaaatcggcttttgag
atagtgcatttcctacctttttatccttattcttcggatgatggattttcggtcattgat
tataaagcggtgaacccagagcttggtgattggaaagatattaaggaaatggaaaagtcg
gcgcgattgatgtttgattttgtttgtaatcatatgtcggcgaaaagtgattggtttaag
cgatatttggcgggtgacgaggagtttaggaacttttttgtggaaatggatccaaagacg
gaccttagttcggtaacaaggccacgtgcgacaccagtactgacaccatttcaatttgat
tcaggaaaagtagggcatatttggacgacgtttagtgaggatcagattgatttgaacttt
gcttgtccggaagtgctttataagatgattgatgttttaatgttctatctagaagaagga
gcagaatatgtgcgacttgatgcggttggatttatgtggaaggtgccgggaacaagctcg
attcacttggaagagacgcatgaaatcgtgaaattatttagagatttagtagatattgca
gcaccagggacgattattataactgaaaccaatgtgccgcatgttgataatattagttat
tttggaaatggtgaaaaagaagcgcatatggtttatcaattcccgcttccaccacttgtg
ctccatgctatccatcatggtaatgcaaaattcctccgtaactgggcgaagaatttagag
ctaccagaaggcaagcggacattctttaatttccttgcctcacatgatgggattgggtta
aatccagtgcgcagaattattccagaagctgagattttggctttagtgaatgatttggag
gaagaaggtgcgctcgtttcttacaagcaaaatccagatggttctaagagtccttatgaa
ataaacgtgacgtacatggatgcgctaagtaaacaggcggacacagatgatttgcgactt
gcaagattccttgtggctcatgcagtattgatgtctatcccaggcgttccagccgtttat
gttcaaagtattttaggaagccgcaatgattatttaggcgtagaagcaacaagtcacaat
cgctctattaatcgaaaaaaatacgacttggcggaaattacagcagagttggaacaaaga
ggctccttacgaaaagcaacttatgatgcgctaacgaaattaattagcacacgaaaagcg
gaatcacttttccatccagaaataccgatggaagttttagaatctacggcggaattgttt
gttgttaaacgttcatccgacgcagaatcgattatattgattcataatttatcagaaaaa
gaagtgagttattcactagacagcggtgtttatacaaatctttataagggctccacagta
actgggagcgattccataaagcttagtggctatgaattctgctggctaaaaaccaaaaat
tacagggaggaacaaaaatga

DBGET integrated database retrieval system