KEGG   Listeria monocytogenes La111: BN418_3368Help
Entry
BN418_3368        CDS       T02512                                 

Definition
(GenBank) Putative sucrose phosphorylase
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
lmoe  Listeria monocytogenes La111
Brite
Enzymes [BR:lmoe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     BN418_3368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: CCQ22416
Position
complement(2759402..2761102)
Genome map
AA seq 566 aa AA seqDB search
MTNLRKRLSRLYAEDVVDSLAARIEARVQQTQQRKLTRKDQWDEKDIVLITYGDQFKEES
QKTLTTFKKMYDSYLKSAFEIVHFLPFYPYSSDDGFSVIDYKAVNPELGDWKDIKEMEKS
ARLMFDFVCNHMSAKSDWFKRYLAGDEEFRNFFVEMDPKTDLSSVTRPRATPVLTPFQFD
SGKVGHIWTTFSEDQIDLNFACPEVLYKMIDVLMFYLEEGAEYVRLDAVGFMWKVPGTSS
IHLEETHEIVKLFRDLVDIAAPGTIIITETNVPHVDNISYFGNGEKEAHMVYQFPLPPLV
LHAIHHGNAKFLRNWAKNLELPEGKRTFFNFLASHDGIGLNPVRRIIPEAEILALVNDLE
EEGALVSYKQNPDGSKSPYEINVTYMDALSKQADTDDLRLARFLVAHAVLMSIPGVPAVY
VQSILGSRNDYLGVEATSHNRSINRKKYDLAEITAELEQRGSLRKATYDALTKLISTRKA
ESLFHPEIPMEVLESTAELFVVKRSSDAESIILIHNLSEKEVSYSLDSGVYTNLYKGSTV
TGSDSIKLSGYEFCWLKTKNYREEQK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaagaaaacgactttcgcggttatatgccgaagatgtggtagatagtttg
gcagctagaatcgaagcacgggtacagcaaacgcaacaacgaaagttaacgcgaaaagat
cagtgggacgagaaagatattgttttaattacatatggggaccaatttaaagaggaatcc
caaaaaacgttaacaacttttaaaaaaatgtatgatagttatttaaaatcggcttttgag
atagtgcatttcctacctttttatccttattcttcggatgatggattttcggtcattgat
tataaagcggtgaacccagagcttggtgattggaaagatattaaggaaatggaaaagtcg
gcgcgattgatgtttgattttgtttgtaatcatatgtcggcgaaaagtgattggtttaag
cgatatttggcgggtgacgaggagtttaggaacttttttgtggaaatggatccaaagacg
gaccttagttcggtaacaaggccacgtgcgacaccagtactgacaccatttcaatttgat
tcaggaaaagtagggcatatttggacgacgtttagtgaggatcagattgatttgaacttt
gcttgtccggaagtgctttataagatgattgatgttttaatgttctatctagaagaagga
gcagaatatgtgcgacttgatgcggttggatttatgtggaaggtgccgggaacaagctcg
attcacttggaagagacgcatgaaatcgtgaaattatttagagatttagtagatattgca
gcaccagggacgattattataactgaaaccaatgtgccgcatgttgataatattagttat
tttggaaatggtgaaaaagaagcgcatatggtttatcaattcccgcttccaccacttgtg
ctccatgctatccatcatggtaatgcaaaattcctccgtaactgggcgaagaatttagag
ctaccagaaggcaagcggacattctttaatttccttgcctcacatgatgggattgggtta
aatccagtgcgcagaattattccagaagctgagattttggctttagtgaatgatttggag
gaagaaggtgcgctcgtttcttacaagcaaaatccagatggttctaagagtccttatgaa
ataaacgtgacgtacatggatgcgctaagtaaacaggcggacacagatgatttgcgactt
gcaagattccttgtggctcatgcagtattgatgtctatcccaggcgttccagccgtttat
gttcaaagtattttaggaagccgcaatgattatttaggcgtagaagcaacaagtcacaat
cgctctattaatcgaaaaaaatacgacttggcggaaattacagcagagttggaacaaaga
ggctccttacgaaaagcaacttatgatgcgctaacgaaattaattagcacacgaaaagcg
gaatcacttttccatccagaaataccgatggaagttttagaatctacggcggaattgttt
gttgttaaacgttcatccgacgcagaatcgattatattgattcataatttatcagaaaaa
gaagtgagttattcactagacagcggtgtttatacaaatctttataagggctccacagta
actgggagcgattccataaagcttagtggctatgaattctgctggctaaaaaccaaaaat
tacagggaggaacaaaaatga

DBGET integrated database retrieval system