KEGG   Loa loa (eye worm): LOAG_10519Help
Entry
LOAG_10519        CDS       T02664                                 

Definition
arginine kinase
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
loa  Loa loa (eye worm)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LOAG_10519
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     LOAG_10519
Exosome [BR:loa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   LOAG_10519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 358 aa AA seqDB search
MAHVDVVAKIEESFSKLQEAKDCHSLLKKHLSKAIVDQLKDKRTKLGATLLDVIQSGVAN
LDSGVGVYAPDADSYTLFKPLFDPIIEEYHNGFGSNQKQPETDLGEDKINLLADLDPEGQ
YINSTRVRCGRSLQGYPFNPCLTEENYKEMENKIKKVLCGFSDPELKGTYYPLAGMTKDI
QKQLIEDHFLFKEGDRFLQAANACRYWPTGRGIYHNESKTFLIWINEEDHLRIISMQKGG
NVGQVLERLIKGLKTIEKSLPFSRDSRLGWLTFCPTNLGTTIRASVHIRLPKISAKPDFK
KICDGLKLQIRGIHGEHSESADGVYDISNKARLGLTEFEAVKQMHDGVKQLIEMERKA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcacatgtggatgttgttgctaaaatcgaagaaagcttcagcaaattacaggaagca
aaagattgccattctctgctcaagaagcatttatcaaaagctatcgttgatcaattgaaa
gataaaaggacaaaacttggtgcaacacttctggatgttatacagtccggtgtagcgaat
cttgattctggtgtaggcgtgtatgcaccagatgctgattcatacactctgtttaaacca
ctgttcgatccaatcattgaggaatatcataatggcttcggatcaaatcagaaacaaccg
gaaaccgaccttggcgaggacaaaataaatttgctcgctgatttggatccggaaggacaa
tacatcaactcaacaagagtacgctgtggacgttctcttcaaggttaccctttcaatcct
tgtcttacggaagaaaactacaaagaaatggaaaataaaatcaaaaaggttctatgcgga
ttctccgatccagaattgaaagggacgtattatccgttggctggaatgacaaaagatatt
caaaaacaacttattgaagatcactttttgttcaaagaaggtgacaggttcttgcaagct
gcaaatgcctgccgatactggccaactgggagaggtatttaccacaatgaaagcaaaact
ttcctgatatggatcaatgaggaggatcatctacgcataatatccatgcaaaagggtggt
aatgttggacaagtattggaacgactcattaaaggtttgaagaccattgagaaaagttta
ccgttctccagagactcacgtctcggttggcttactttctgcccaacaaatttgggtact
acgatacgtgcatcggtacacatacgtcttccaaagattagtgcaaagccggatttcaag
aagatatgtgatggactgaaacttcaaatacgtggtatacatggagaacattccgaatca
gcagatggtgtttacgacatctcaaataaagctcgtcttggattgacggaatttgaggct
gtgaaacagatgcatgatggtgtgaaacagctcatcgagatggaaaggaaggcttag

DBGET integrated database retrieval system