KEGG   Lactobacillus reuteri DSM 20016: Lreu_0346Help
Entry
Lreu_0346         CDS       T00535                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lre01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:lre00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(392205..392993)
Genome map
AA seq 262 aa AA seqDB search
MTHKIQKAVVKIGTSSLVLPNGKINLRTIDQLSFVLATLNNQGYQLILVSSGAIGVGLAS
LGLKDRPAEIAQQQALASIGQAALMRIYSQRFLDYQTHVAQLLLTRDVLTYPISRQHTLN
TINTLLQQNVIPIVNENDPVSVDELDHYTTFSDNDELSSQVAVAIDADELIILSDIDALY
DKDPHKFSDAHIIKEVPVLTPEIENAASGSSTRFGTGGMVTKLRAAATMMQAGKQMILCN
GRDPKILFDIFDGHTIGTHFGK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgactcataaaatacaaaaagcagttgttaagattggtacgagtagccttgttctccct
aatggaaaaattaatttacgaacaatcgaccaactctcctttgtccttgcgacattaaat
aatcaaggataccaacttattcttgtttcctcaggagcaattggcgttggtcttgcaagt
ttgggattaaaagatcgtcccgccgaaatagcacaacagcaagccctagcatctatcggt
caagctgctttaatgcgaatctattcgcaacgctttttagattatcaaacgcacgtcgcc
cagcttctccttacccgtgatgtgctcacttatcctattagtcgccagcatacgcttaat
acaattaatactttactgcagcaaaatgtgattccaatcgttaacgaaaatgaccccgtt
tcagttgatgagcttgatcattacactacttttagtgacaatgatgaactttcttcccag
gtagctgtcgccattgacgctgacgaactaatcattctttcggatatcgatgccctttat
gacaaagatccgcataaattttctgacgcacacataattaaagaagtgccagtcctaacg
cccgaaatagagaacgccgcaagtggtagcagcactagatttgggacaggcggaatggta
actaaattacgggcagctgccacaatgatgcaagcaggcaaacaaatgattttatgcaat
ggtcgtgaccctaaaattctttttgatatttttgatggtcatactattggtactcatttt
ggaaaatag

DBGET integrated database retrieval system