KEGG   Lactobacillus reuteri DSM 20016: Lreu_0346Help
Entry
Lreu_0346         CDS       T00535                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lreu_0346
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Lreu_0346
Enzymes [BR:lre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Lreu_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(392205..392993)
Genome map
AA seq 262 aa AA seqDB search
MTHKIQKAVVKIGTSSLVLPNGKINLRTIDQLSFVLATLNNQGYQLILVSSGAIGVGLAS
LGLKDRPAEIAQQQALASIGQAALMRIYSQRFLDYQTHVAQLLLTRDVLTYPISRQHTLN
TINTLLQQNVIPIVNENDPVSVDELDHYTTFSDNDELSSQVAVAIDADELIILSDIDALY
DKDPHKFSDAHIIKEVPVLTPEIENAASGSSTRFGTGGMVTKLRAAATMMQAGKQMILCN
GRDPKILFDIFDGHTIGTHFGK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgactcataaaatacaaaaagcagttgttaagattggtacgagtagccttgttctccct
aatggaaaaattaatttacgaacaatcgaccaactctcctttgtccttgcgacattaaat
aatcaaggataccaacttattcttgtttcctcaggagcaattggcgttggtcttgcaagt
ttgggattaaaagatcgtcccgccgaaatagcacaacagcaagccctagcatctatcggt
caagctgctttaatgcgaatctattcgcaacgctttttagattatcaaacgcacgtcgcc
cagcttctccttacccgtgatgtgctcacttatcctattagtcgccagcatacgcttaat
acaattaatactttactgcagcaaaatgtgattccaatcgttaacgaaaatgaccccgtt
tcagttgatgagcttgatcattacactacttttagtgacaatgatgaactttcttcccag
gtagctgtcgccattgacgctgacgaactaatcattctttcggatatcgatgccctttat
gacaaagatccgcataaattttctgacgcacacataattaaagaagtgccagtcctaacg
cccgaaatagagaacgccgcaagtggtagcagcactagatttgggacaggcggaatggta
actaaattacgggcagctgccacaatgatgcaagcaggcaaacaaatgattttatgcaat
ggtcgtgaccctaaaattctttttgatatttttgatggtcatactattggtactcatttt
ggaaaatag

DBGET integrated database retrieval system